KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11112Help
Entry
HMPREF0772_11112  CDS       T01889                                 

Definition
(GenBank) D-ala D-ala ligase N-terminal domain protein
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF0772_11112
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0772_11112
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HMPREF0772_11112
Enzymes [BR:suq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HMPREF0772_11112
Peptidoglycan biosynthesis and degradation proteins [BR:suq01011]
 Precursor biosynthesis
  Amino acid ligase
   HMPREF0772_11112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1177760..1178941
Genome map
AA seq 393 aa AA seqDB search
MILLRFKDANKSFNNWTKSILIYIKVANPDISLEENEMTKENICIVFGGKSAEHEVSILT
AQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITTEIKSTDELHLENGEALEISQLLKESS
SGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLP
QLPYISFLRSEYEKYEHNILKLVNDKLNYPVFVKPANLGSSIGISKCSNEAELKEGIKEA
FQFDRKLVIEQGVNAREIEVAVLGNDYPEATWPGEVVKDVAFYDYKSKYKDGKVQLQIPA
DLDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDNQIYINETNAMPGFTAFSMYPKLW
ENMGLSYPELITKLIELAKERHQDKQKNKYKID
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgatactattaagattcaaagatgcgaataaatcatttaacaattggactaaatcaata
ttaatttatattaaggtagcaaaccctgatatatcattggaggaaaacgaaatgacaaaa
gaaaatatttgtatcgtttttggagggaaaagtgcagaacacgaagtatcgattctgaca
gcacaaaatgtattaaatgcaatagataaagacaaatatcatgttgatatcatttatatt
accaatgatggtgattggagaaagcaaaataatattacaactgaaattaaatctactgat
gagcttcatttagaaaatggagaggcgcttgagatttcacagctactgaaagaaagtagt
tcaggacaaccatacgatgcagtattcccattattacatggtcctaatggtgaagatggc
acgattcaagggctttttgaagtattggatgtaccatatgtaggaaatggtgtattgtca
gctgcaagttctatggacaaacttgtaatgaaacaattatttgaacatcgagggttacca
cagttaccttatattagtttcttacgttctgaatatgaaaaatatgaacataacatttta
aaattagtaaatgataaattaaattacccagtctttgttaaacctgctaacttagggtca
agtataggtatcagtaaatgtagtaatgaagcggaacttaaagaaggtattaaagaagca
ttccaatttgaccgtaagcttgttattgaacaaggcgttaacgcacgtgaaattgaagta
gcagttttaggaaatgactatcctgaagcgacatggccaggtgaagtcgtaaaagatgtc
gcgttttacgattacaaatcaaaatataaagatggtaaggttcaattacaaattccagct
gacttagacgaagatgttcaattaacgcttagaaatatggcattagaggcattcaaagcg
acagattgttctggtttagtccgtgcggatttctttgtaacagaagacaaccaaatatat
attaatgaaacaaatgcaatgcctggatttacggctttcagtatgtatccaaaattatgg
gaaaatatgggcttatcttatccagaattgattacaaaacttatcgagcttgctaaagaa
cgtcaccaggataaacagaaaaataaatacaaaattgactaa

DBGET integrated database retrieval system