KEGG   Stigmatella aurantiaca: STAUR_1258Help
Entry
STAUR_1258        CDS       T01425                                 

Definition
(GenBank) AMP-binding protein
Organism
sur  Stigmatella aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1530886..1532643
Genome map
AA seq 585 aa AA seqDB search
MKGPALSPVKYATLPEMLEATSRTALGLTFVDASEQEVSLSWAEVYRRARQTAAGLQRVG
VKPGEAVAILLPTSPGFMDAFFGVLLAGAVPVPLYPPVRLGRMEEYHRATARMLSVSEAV
LVLTETRLKLLLGASVEAARPRFGCRTVEELSRGDGALSVAVSPQSLGLIQFSSGSTVAP
KPVVLTQAALMAQMAALEASLPSPSGGVPVGVSWLPLYHDMGLIGCLLSALYYPGNLVLL
PPEVFLARPALWLRALSRHKGFVSPAPNFAYGLCLKRVKDEELQGVDLSGWKHALNGAEP
VSAETLRRFVSRFSRYGFSGEALRPVYGLSEAALAVTFPPSGRGLRSRSVDAGVLAREGR
AVGGARELVSVGSPVPGFEVVVRNELGVELPELRTGRVYARGPSLMKGYHGDGDGTARVL
GADGWLDTGDLGFVAEGELYLTGRAKDLVIIRGANHAPQAFEECVQTVEGVRLGCAVALG
FTPEGSEDEALLILAERAGSPDDDGQVEAQVSAAIVQGTGIRPHTVRLLKPGTLPRTSSG
KLRRGEALRQFLAGELLPPKRVGAVSIMVEMAKGALALARTGREG
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcctgccttgtccccggtgaagtacgccaccctcccggagatgctcgaggcc
acgtcgcgcacggcgctggggctcaccttcgtggatgcctccgagcaggaggtttcgctg
tcctgggcggaagtgtaccgccgggcccggcagacggccgcggggctgcagcgcgtgggg
gtgaagcccggggaggccgtggccatcctcttgccgacgtctccggggttcatggatgcc
ttcttcggggtgctgctggccggtgcggtgcccgtgccgctctatccgccggtgcggctg
ggacggatggaggaataccaccgcgccacggcgcgaatgctgagcgtctcggaggcggtg
ctggtgctcaccgagacgcggttgaagctgcttctgggcgcctcggtggaagcggcgcgt
ccgaggttcggttgccggacggtggaggagctctctcgcggtgacggggcgctgtccgtg
gccgtgtctccccagtccctgggcctcatccagttctcctcgggatcgaccgttgccccc
aagccggtggtgctcacccaggcggccttgatggcgcagatggccgcgctcgaagcctcc
cttccttcgccttcaggaggcgtgcccgtgggggtgtcgtggctgccgctgtaccacgac
atggggctcatcgggtgcttgctctcggcactgtattacccgggcaacctggtgctgctg
ccaccggaggtctttctcgcgcggcccgcgctgtggctccgtgcgctttcgcgccacaag
gggttcgtctctcccgcacccaacttcgcctatggcctgtgcctcaagcgggtgaaggat
gaggaactgcaaggggtggacctgtcgggctggaagcatgcgctcaatggggcggagcct
gtctctgccgagacgctgcgccgcttcgtctcgcgcttctcccggtacggcttctccggg
gaggcgctgcggccggtctacgggttgtccgaggcggccttggccgtcacctttccgccc
agtgggagggggctgcgctcacggagcgtggacgcgggcgtgctggcccgggagggccgt
gcggtcggtggagcgcgcgaactggtgtccgtgggcagtccggtcccgggcttcgaggtg
gtggttcggaatgaactcggcgtcgagttgcccgaactgcggaccgggcgtgtctatgcg
cggggcccctccttgatgaagggataccacggtgatggggacggcaccgcgcgggtcctg
ggggccgatggatggctggacacaggggacctggggttcgtggcggagggcgagctgtac
ctcaccgggcgtgcgaaggatctggtcatcatccggggcgcgaaccatgcgcctcaggcc
ttcgaggagtgcgtgcagaccgtggagggagtgcgcttgggatgtgcggtggcgctcggc
ttcacccccgagggcagcgaggacgaggcattgctcatcctcgcggagcgcgcgggttcg
cccgacgacgacgggcaggtggaggcgcaggtgagtgccgccatcgtgcagggcacggga
atccggccgcacacggtgcgcctgctgaagccggggacgttgccgcgcacctccagcggc
aagctgcgccggggcgaggcgctgcggcagttcctggcaggggagctgctgcctccgaag
cgggtgggggcggtgagcatcatggtggagatggcgaagggcgcgttggcgctggcccgg
acggggcgggagggatga

DBGET integrated database retrieval system