KEGG   Stigmatella aurantiaca: STAUR_4035Help
Entry
STAUR_4035        CDS       T01425                                 

Gene name
pyk
Definition
(GenBank) Pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_4035 (pyk)
   01230 Biosynthesis of amino acids
    STAUR_4035 (pyk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_4035 (pyk)
   00620 Pyruvate metabolism
    STAUR_4035 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    STAUR_4035 (pyk)
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     STAUR_4035 (pyk)
Exosome [BR:sur04147]
 Exosomal proteins
  Proteins found in most exosomes
   STAUR_4035 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4889224..4890624)
Genome map
AA seq 466 aa AA seqDB search
MRKAKIICTLGPASDTPEVIEGLVRAGMNVARINFSHGVYEDHRRRVNTLRKVSRKLGIP
VAILQDIQGPKIRLGRFEGGQLLVQAGQTVTVTTRAVLGQGTLIPTPVRSLTRDVTRGDM
ILLDDGRVRLRVVRVAGRDVTATVEVGGLLKDHKGLNLPGAAISVPTITEKDAEDLAFGQ
ELGVDYVALSFVRTANDIHQARTHVSKLKTPLIAKIEKPQALENLEAISEAADGVMVARG
DLGVEMPLEQLPGIQKRMVAEVNRKGGLVIVATEMLESMVGNARPTRAEVSDVANAILDG
ADAVMLSGETAAGKYPIDAAATMARIVEETERSLPSSLRPSLKVGTQDLSAGVAAAAVAA
AEQLGIGTIVAYTERGHTARLISEFRPKARIIGLTPNADTVNRMALYWGVQGRQVTRLQS
TDAMLKQVRRLCREQAFCEPGSPVVIVAGVPLNEPGNTNMMSVHRI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggcgaaaatcatctgtaccctgggacctgcctcggacactcccgaggtcatc
gagggcctcgtgcgcgccgggatgaacgtggcgcgcatcaacttctcgcacggtgtctac
gaggaccatcggcgccgcgtgaacaccctgcgcaaggtgtctcgcaagctcggcatcccg
gtggccatcctccaggacatccaggggccgaagattcgcctgggccgcttcgagggcggc
cagttgctggtgcaggcggggcagacggtcaccgtgacgacgcgcgccgtgctcggccag
ggcacgctcattcccacccccgtccgctccctgacaagagacgtgacgcgcggggacatg
atcctcctggatgacggccgggtgcggctccgggtggtgcgcgtggcgggccgggacgtc
accgcgaccgtggaggtgggcgggctgctcaaggaccacaaggggctcaacctgccgggc
gcggccatctcggtgcccaccatcacggagaaggatgcggaggacctggcgttcgggcag
gagctcggcgtggactacgtggcgctctccttcgtgcgcacagcgaacgacatccaccaa
gcccgcacccacgtctcgaagctgaaaacacccctcatcgcgaagatcgagaagccccag
gcgctcgagaacctggaggccatctccgaggccgcggacggggtgatggtggcccggggc
gatctgggggtggagatgccgctggagcagctgccgggcatccagaagcgcatggtggcg
gaggtcaaccgcaagggcgggctggtcatcgtcgccaccgagatgctggagagcatggtg
ggcaacgcccggcccacgcgggccgaggtctccgacgtggccaacgccatcctggatggg
gcggacgcggtgatgctctcgggggagacggccgcgggcaagtaccccatcgacgcggcg
gcgacgatggcgcgcatcgtggaggaaacggagcgaagcctcccctcctccctgcgcccg
tccctgaaggtgggaacgcaggacctgtccgcgggcgtcgccgcggcggcggtggcggcg
gccgagcagttgggcatcggcaccatcgtggcctacaccgagcgaggccacaccgcacgg
ctgatctccgagttccggcccaaggcgcgcatcatcggcctgacgccgaacgcggacacg
gtcaaccgcatggcgctctactggggggtgcaggggcggcaggtgacccggctccagtcc
acggacgccatgctcaagcaggtgcgccggctgtgccgggaacaggccttctgcgagcca
ggctcgcccgtggtcatcgtggcgggggtccccctcaacgagcccgggaacacgaacatg
atgtccgtgcaccgcatctga

DBGET integrated database retrieval system