KEGG   Stigmatella aurantiaca: STAUR_4119Help
Entry
STAUR_4119        CDS       T01425                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sur  Stigmatella aurantiaca
Brite
Enzymes [BR:sur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     STAUR_4119
Peptidases [BR:sur01002]
 Metallo Peptidases
  Family M2
   STAUR_4119
Exosome [BR:sur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STAUR_4119
CD molecules [BR:sur04090]
 Proteins
  STAUR_4119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4987554..4989368
Genome map
AA seq 604 aa AA seqDB search
MLPLLRAACAAVALLALPSAAQQGKATPEEAKQFVERLNADLKRLWTKQATAEWIKSTYI
TDDTERNAASINEEVLAYLNQAIKDSRRFDGLKLDPDTARMIHLLKVNSAIAAPSDAQKR
SELASSAAKLEGLYGKGKYCSKDKAGKELCRDLGQLSDVMASSRNYDELLDVWVGWHSIA
PPMRPLYERFVALGNEGAKEIGFANIGNLWKSAYDMPPEQFEQDTQRLWQQVKPLYDELH
CYVRARLAKKYGADKVPAGKPIPAHLLGNMWAQEWNNIYPLVEPYAGQASLDVSAAIQKQ
RYDAKKMVQLGEKFFTSLGLKPLPATFWERSQFTQPRDRDVVCHASAWDVTYDNDLRIKM
CIKPTEEDLVTIHHELGHDYYFTYYYTLPVLYQSGAHDGFHEAIGDAITLSITPGYLQQA
GLLKSVPRNDKNLINLQLKDALEKVAFLPFGLLIDQWRWDVFAGKTAPEDYNKAWWALRE
KYQGVAAPVARSEKDFDPGAKYHVPANVPYTRYFLARILQFQFHKAMCEAAGHQGALHEC
SVYGNKEAGKRLQAMLEMGASKPWPEALQAMTGQRQMDATPLLDYFSPLRSWLKEQNKGQ
QCGW
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcccctcctccgcgcggcctgtgcggccgtggcgctgctggccttgccctccgcc
gctcaacaaggcaaggccacacccgaggaggcgaagcagtttgtcgagcggctgaacgcc
gatctcaagcgtctctggacgaagcaggcgaccgccgagtggatcaaatccacgtacatc
accgacgacaccgagcggaatgccgcctcgatcaacgaagaggtcctcgcctacctgaac
caggccatcaaggactcccggcgctttgatgggttgaagctggatccagacacggcccgg
atgatccacctgctcaaggtgaactccgccatcgccgcgccttcggatgcgcagaagcgc
tcagagctggcctccagcgccgccaagctcgaaggcctgtatggcaagggcaagtactgc
tccaaggacaaggccgggaaggagttgtgccgggatctgggacagctctcggacgtgatg
gcctcgagccggaactatgacgaactgctggatgtgtgggtggggtggcactccatcgcc
ccccccatgcgtccgctctatgagcgcttcgtggcgctcggcaacgagggcgccaaggag
atcggcttcgccaacatcggcaacctctggaagtccgcctacgacatgccgcccgagcag
ttcgagcaagacacacagcgcctctggcagcaggtgaagccgctctatgacgagctccac
tgctacgtgcgtgcccggctggcgaagaagtacggcgcggacaaggttcccgcgggcaag
cccatccccgcgcacctgctgggcaacatgtgggcgcaggagtggaacaacatctatccg
ctcgtggagccctacgcggggcaggccagcctggacgtgagcgcggcgatccagaagcag
cgctacgacgccaagaagatggttcagctcggcgagaagttctttacctccctgggcctc
aagcccttgccggccacgttctgggagcgctcccagttcacccagccgagagatcgcgac
gtggtgtgtcacgccagcgcttgggatgtgacctacgacaatgacctgcgcatcaagatg
tgcatcaagcccaccgaggaggatctggtcaccatccaccacgagctcggccacgactac
tacttcacctattactacacgctgcccgtgctctatcagtcgggggcccatgatggcttc
cacgaggccatcggcgatgccatcaccctgtccatcaccccgggctatctccagcaggcg
ggcctgctcaagagcgtgccgcgcaacgacaagaacctcatcaacctccagctcaaggac
gcgctggagaaggtggccttcctgccgttcggcttgttgatcgaccagtggcgctgggac
gtgttcgccgggaagaccgccccggaggactacaacaaggcctggtgggccctgcgggag
aagtaccagggggtggccgcgcccgtggcccggagcgagaaggacttcgatccgggcgcc
aagtaccacgtgccggcgaatgtgccgtacacgcggtatttcctggcccgcatcctccag
ttccagttccacaaggccatgtgcgaggcggcgggccatcagggcgcgctgcacgagtgc
tccgtctacgggaacaaggaggcgggaaagaggcttcaagccatgctggagatgggggcg
agcaagccgtggccggaggcgctccaagccatgacggggcagcgccagatggatgccacg
ccgctgctcgattatttcagcccgctccgaagttggctgaaggagcagaacaaggggcag
cagtgcggctggtag

DBGET integrated database retrieval system