KEGG   Stigmatella aurantiaca: STAUR_4992Help
Entry
STAUR_4992        CDS       T01425                                 

Definition
(GenBank) LgrB-like linear gramicidin synthetase subunit B protein
Organism
sur  Stigmatella aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6160545..6169841
Genome map
AA seq 3098 aa AA seqDB search
MPLNRQPLTLIELLEEKASLTPDQPLFTFQEETEGEEKTLSYGELRYRALTIARSVQALA
APGERALLLYPPGLEYIAGFFGCLYAGMVAVPAYPPDPLRLNRTLPRLRAMIQDAQAKVV
LTTSFILSMGESLFEQEPDFKNLHWIATDDLPKGAPDRWVQPSVSGNTLAFLQYTSGSTG
APKGVMLTHDNLLCNLEMIAHTFQIRSDSVCVIWLPPYHDMGLIGGILEPVYTGMRTTLM
SPMSFLKNPFRWLDTISRLKATVSGGPNFAFDLCVRKVTAEQRQRLDLSHWKVAFSGAEP
IRPETLDRFTQTFETCGFRRKAFFPCYGLAEATLIVSGGEVPEPPILCSLRASALEQGQA
VEAPSGELDSRTLVGCGQTVPNQEILIVDPVSSVPCPPGKVGEIWVCGPSVAQGYWQKPT
ETGQIFQARPASGGERVYLRTGDLGFLKERELFVTGRQKDLIIIRGRNHFPQDLELTAEQ
SHPSLRPGCSAAFSVDWEGEEKLVLVQEVDVRKAGDLRAQLDVCKAAATALRQRLAEVHE
VQLHALALIEPGTIFKTSSGKIQRSACREAFLSGALQTVLKWETSNRAVQPRAVHEAAPP
PLLTAAPTDLSTEEGLQSWLVAHVAKQLRIPATSLDPAMPLTGYGLDSLAAVELAHSLEK
GLGFPISMELLLQGSSLAQLARQFFTQRPQEAKDHAPLVSQLPRNNPLPLSYAQQRLWFL
DQLEPGSPRYIIPAAVRIEGALNVPLLEHSFLLLALRHEPLRTTFLSSPQGPSQLISPSS
SFQLQHFDLRSLPPHLRDARLLSLCSELSLLPFSLSQGPLLRACLLHLDEHLFVLFLSMH
HIISDGWSMGVLVRELASLYQSLLHSAPSTLPDLPFQYADFASWQRSWLLGPRLLSQLAW
WREHLCGAPLSLHLPTDFPRPPVLSSRGASVPVLLPASLSRSLHSLCLREGVTPFMALIA
VFQLLLSRYSAQDDICVGFPIANRNLPSLEGLIGFFANTLLLRSRLPPDSSFLQLLSQVR
SSSLGAYAHQDVPFDKLVEAMNPERDLSRSPLFQAMFSLQNTPVLELDEVHLHLRQLELE
SQTCLFDLMLSLEDTGTGFAGKLHYSTDLFTAATASQMARHFLVLMEGLLNNPDQHLSEV
SLLTPQERQQLLEEWSGTAPLASSLCLHHLFEAQVARSPDAIALVVDSTRLSYRELNRRA
NQLAHCLQALGASPDVPIGLCLQRSTDMVIGLLAILKAGAAYVPLDPAYPAERLIYSFQD
AGASLLVTQDTLRHLLPIAGAKTVCLDSGWEPISRESTDNPRSSVLPSNLAYVLYTSGST
GRPKGVAIEHHNAAVFIQWSLNCFSAQQLAGVLASTSICFDLSIFELFAPLCSGGTVLLA
SNALALPSLPAAQEVTLINTVPSAIAELARTNAIPSSIHTLNLAGEPLSGSLVRALYSLP
SIQHVFNLYGPTEDTTYSTFTLIPKDASSEPTIGRPISGTRAYVLDRQLHLVPRGVPGEL
YLSGSGLARGYINRPELTAERFLPNPFSTEPGSRLYKTGDLARFAVDGNLEYLGRIDHQV
KIRGFRIELGEIESILLTQPGLHQAAVLAHEEAPGDKRLVAYVVAARNHSFTPAELRRLL
KERLPDYMVPSAFVLLDALPLTPNGKLDRKALPRPGAPSLEQKGFVPPHTQTEKALAEMW
CELLNIDRVGIQDHFFELGGHSLLASQVISRIRSALGVELPLRSLFESPSLESFATAVDS
ALNSPQAPQLPQRLPPQSRPGPLPLSYAQQRLWFLDQLEPGSPRYIIPAAVRIEGALNVP
LLEHSFLLLALRHEPLRTTFLSSPQGPSQLISLSSSFQLQHFDLRSLPPHLRDARLLSLC
SELSLLPFSLSQGPLLRACLLHLDEHLFVLFLSMHHIISDGWSMGVLVRELASLYQSLLH
SAPSTLPDLPFQYADFASWQRSWLLGPRLLSQLAWWREHLRGAPLSLHLPTDFPRPPVLS
SRGASVPVLLPASLSRSLHSLCLREGVTPFMALIAVFQLLLSRYSAQDDICVGFPIANRN
LPSLEGLIGFFANTLLLRSRLPPDSSFLQLLSQVRSSSLGAYAHQDVPFDKLVEAMNPER
DLSRSPLFQAMFSLQNTPVLELALPELVLHPMELPSQTAKFELLLSLSEDTEGFSGILEY
NTDLFTAATISQMAEHFCVLLEDVLAHPERRLDQLSPLFSPEEHPLLVKRHDRELPQQAL
TEPPPSSVAALPLSSIHLTLVDIWKEVLSLQHVGIHDDFFTRGGNSISSILVVARLQEAG
LHLSPDQIFQKRTIAELAPLVTSARKTEGQGEITGALPLTPIQRWFFDTWEQHAHHFNQA
VMLEVLEDIEAAVLEGALQKLLEHHDALRLRFERTGDGWRQENGGAGRPIALKQVDVSGL
TQEAQTQTLAKVAEEEQESFDLAEGQLLRAVLFHRGQGRTGRLLLVIHHLGVDGLSWRTL
IEDLEKAYKHLSSGGEAVLGTKTTSFKTWAEHLELYAGTQDVEEQLPYWEKQGQEEVGPL
PVDKAVGANTVVSEDRVTVRLEEEETRALLQEVPTAYGTRVEEVLLAALTATMGRWTGLD
RISVSMEGHGREELFEDVDLSRTVGWFTSLYPMVLDTGKAERPEDKLQAVSNRLKGLPMK
GLGYGLLRYLGRDEIVKKLERLSSPELLFNYLGEFDASASRLSMFRPTREETGPARSREG
LRSHLLEVNGLVFDWRLELTWSYSQNRHERATIERLAQGFMSELRGFIDHQKTAIAHKNT
PANESLSVRLEQVTQGLIHDQQMLGTALLVELADRRRVHMAKGTSDPAGTPYTQTTRVLI
GSLTKMFTAVAILQLVEDGRLSLDATVNEWLPWLMRGKAITLRDLLAHTSGLPDYLSRLT
LLDTAKPCSPRSLVELAEHEPAVPPGHYSNTNYIVLGLLLEALTGSTWEEEISRRILEPL
GLIRTTPLTESPPEDLVGAWKRGDDGWKDIRPVWHPSCGWAAGGMISTTEELVTFGRALF
SGALFKSPDTLAAMRSYSVSSTPHMAVGVEHEMGLCLHLFRVAGITLEGHLGERPGYSAV
LLHDPETQAIVAATANTHGALTAFAGVKALEAVRRATS
NT seq 9297 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgaaccggcagcctctcaccctgatcgaactcctcgaagagaaagcctcactg
acgcctgatcaacctctcttcacattccaggaagagacggagggcgaggagaaaaccctg
tcttacggtgagttgcgctaccgggcgttgacgattgcacgctcggtccaagcgctcgcc
gctcccggagagcgggcgcttctgctgtatcctcccgggttggaatacatcgcggggttc
ttcggctgcctgtatgcaggcatggtcgcagtgccagcctatccgccggatccgctccgg
ctgaaccgcacccttccccggctgcgcgccatgatccaggatgcgcaggccaaggtggtc
ctcaccacatcgttcatcctctcgatgggtgagtctctcttcgagcaggaaccggatttc
aagaacctccactggatagccaccgacgacctcccaaaaggtgccccggatcgctgggtc
caaccgagtgtttcaggtaacacgctcgctttcctccaatacacttctggctccacagga
gcgcccaagggagtgatgctcacgcatgacaacctgctgtgcaacctggagatgatcgcc
cacacctttcaaatccggtctgacagcgtttgcgtcatctggctgcctccgtaccacgac
atgggtctgattggaggcatcctggagcctgtctacacaggcatgaggaccacgctcatg
tcgccgatgagcttcctcaagaatccttttcgatggctggacaccatctcccgtctcaaa
gcgaccgtcagtggtggcccgaatttcgctttcgatctctgcgtccgaaaagtgaccgcc
gaacagcgtcagcgactcgacttaagtcactggaaggtggcgttctccggcgccgagccc
atacgtccagagacactcgatcgcttcactcagactttcgaaacatgcggtttccgccgg
aaagccttcttcccttgttatgggttggcagaggcaaccctcatcgtttccggtggcgag
gtgcccgagccccccatcctgtgttcgctgcgagcatcggccctggaacaaggtcaggct
gtggaggccccttcaggagaactggattcgcggacgctggtggggtgtggccagacggtc
cccaaccaggaaatcctcatcgtggacccggtatcatcggtcccatgcccacctggcaag
gtcggcgaaatctgggtctgcggccccagcgtcgcgcagggctattggcagaagcccacg
gagaccgggcagatcttccaggcacggcccgcgagtgggggtgagcgcgtctatctccgg
acaggagacttgggttttttgaaggagagagaactctttgtcacgggccgacagaaggac
ctgatcatcatccgcgggcgcaatcacttccctcaggatctggagctgacggcggagcag
agccatccatcgcttcggcctggctgctcagcagcgttctctgtcgactgggagggagag
gaaaagcttgtgctcgtccaagaggttgacgttcgcaaggctggagacttgcgggcgcag
ctggacgtctgtaaggccgcagccaccgcactccgccagcgactcgccgaggtgcacgag
gtccaactccacgccctggcgttgatcgagccgggcaccattttcaagacatccagtggc
aagatccagcgcagcgcgtgccgggaggccttcctgtcgggcgcgctgcaaaccgtgctg
aagtgggagacgagcaaccgggcggtgcagcctcgagcagttcacgaagcagcacctccc
cccttgttgacggcggcgcctaccgatctgagcactgaagagggacttcagtcctggctg
gttgcccatgtcgccaagcagctccgcatccccgccacatcactcgatccagccatgccc
ctcaccggctacggcctggactcgctggccgcagtggagctggcacactcgctcgaaaag
ggccttgggttccctatttccatggagctactgcttcagggctccagtctcgcccagctc
gcgcgccagttcttcacgcagcgtccccaggaagccaaagatcatgcgccgctggtgagt
cagctgccacgaaacaaccccctgccgctgtcgtacgcacagcaacgcctgtggttcctg
gaccaactggagcccggcagcccccgctacatcatccccgccgccgttcgcatcgaaggc
gctctcaatgttcccctcctcgagcactccttcctcctcctggccctgcgccatgagccc
cttcgcaccaccttcctctcctccccccaggggccctctcagctcatctccccctcttcc
tccttccagctccaacacttcgacttgcgctcccttcctcctcacctgcgcgacgctcgc
ctcctctccctctgctctgaactctccctccttcccttctccctctctcagggccccctt
ctccgcgcctgccttcttcacctggatgagcacctcttcgtcctcttcctctccatgcac
cacatcatctccgatggctggtccatgggcgtcctcgtccgcgagttggcctccctctac
cagtccctgctccactcagctccctccaccctcccagacttgcctttccagtacgctgac
ttcgcctcctggcaacgctcctggctcctcggccctcgcctcctctctcaactggcctgg
tggcgcgaacacctttgcggtgcccccctctctcttcacctccccaccgacttccccagg
cctcccgtcctctcctctcgcggggcctccgtccctgttctccttccggcctctctctcc
cgctccctccactccttgtgccttcgtgagggcgttactcccttcatggctctcatcgcc
gtcttccagttgctcctgtctcgctactccgctcaggacgacatctgcgtcggcttcccc
atcgccaaccgcaacctcccttccctcgaaggcctcatcggcttcttcgccaacaccctc
ctcctccgctcccgccttcctcctgactcctccttccttcaactcctctctcaggtccgc
tcctcctccctcggcgcctatgctcaccaggatgtccctttcgacaagctcgtcgaggcg
atgaaccccgagcgggacctcagccgctctcctctcttccaggccatgttctcccttcag
aacactcccgtcctcgagctggatgaggtccaccttcatttgcgccagctcgagttggaa
agccagacctgtctcttcgacctgatgttgtcacttgaagacaccggcacgggcttcgcg
ggcaagctccactacagcaccgatctcttcacggcagccaccgcctctcaaatggccaga
cacttcctcgtactgatggagggcctcctcaacaacccagatcagcacctctcggaagta
tcgctcctgacgccccaagagcggcaacaactcctggaagagtggagtggcacagctccg
ctcgccagctccctgtgtctccaccacctctttgaagcccaggtggcgcgcagcccggat
gccatcgcgctcgtcgttgactccacccggctcagctaccgggaactcaaccgccgtgcc
aaccaactcgcgcactgcctgcaagccctcggagccagtcccgatgtacccattggcctc
tgcctccagcgctccactgacatggtgatcggccttcttgcaatcctgaaagccggcgca
gcctacgttccccttgaccctgcttaccccgccgaaagacttatctattcctttcaggac
gctggcgcttcccttctcgtcacccaggacacgcttcgccatctcttgccaatcgctggc
gccaagactgtctgcctcgattccggctgggaaccgatctctcgcgagtccacagacaac
ccacgctcctccgtcttgccgtcgaatctcgcctacgtcctttacacctctggatctaca
ggcagacccaaaggggtcgccatcgagcaccacaacgccgccgtcttcatccaatggtcg
ctcaactgcttctcggcccagcaactggccggcgtcctcgcctccacgtccatctgcttc
gatctctccatcttcgaactcttcgcgccgctctgctccggcggcaccgttctgcttgcc
agcaacgccctcgcgctgccctcgctcccggccgcccaagaggtcaccctcatcaacacg
gtcccatccgccatcgcggaattggcccgtaccaacgccatcccgtcctccattcacacc
ctcaatctggctggagagcctctttctggctccctcgtgcgagccctgtactcgcttccc
tccatccaacacgtcttcaacctttatgggcccaccgaggacaccacctactccaccttc
accctcattccgaaggacgcctcatccgagcccaccatcggccgtcccatctccggcaca
cgggcctatgtactggaccggcaacttcacctcgttccccggggtgttcccggcgaactc
tatttgtccggctcgggcctggctcgaggatatatcaaccgcccagagctgaccgccgag
cgattcctcccaaaccctttcagcactgaacccgggagccgcctctacaagaccggcgac
ctcgcacgctttgccgtggatggaaaccttgagtacctcggccgcatcgatcatcaggtc
aagatccgcggcttccgcatcgagctgggggagattgagtccatcctcctcacccaacct
gggctgcaccaggcagccgtgctcgcccacgaagaagcccctggagacaagcgccttgtc
gcttacgtcgttgcggcccggaaccactctttcaccccggcggagttgcgacgccttctc
aaggaacgattgcctgactacatggtcccttcggccttcgtcttgctcgacgccctgcca
cttacccccaatggcaaactcgaccgcaaagccctcccacgccctggtgccccctcactg
gagcagaagggcttcgtccccccgcatacacagacggagaaggccttggccgagatgtgg
tgcgaactgctcaatatagacagggtcggcatccaggaccacttctttgaactcggcggc
cactccttgctggcctctcaagtcatctcacgcatccgcagcgcgctcggcgtcgaattg
cctttgcgctcgcttttcgagtccccctcccttgagtctttcgccaccgcggttgactcc
gccctgaactccccacaagcccctcagctcccccaacggctgcctccacagtcccgccct
ggccccctgccgctgtcgtacgcacagcaacgcctgtggttcctggaccaactggagccc
ggcagcccccgctacatcatccccgccgccgttcgcatcgaaggcgctctcaatgttccc
ctcctcgaacactccttcctcctcctggccctgcgccatgagccccttcgcaccaccttc
ctctcctccccccaggggccctctcagctcatctccctctcttcctccttccagctccaa
cacttcgacttgcgctcccttcctcctcacctgcgcgacgctcgcctcctctccctctgc
tctgaactctccctccttcccttctccctctctcagggcccccttctccgcgcctgcctt
cttcacctggatgagcacctcttcgtcctcttcctctccatgcaccacatcatctccgat
ggctggtccatgggcgtcctcgtccgcgagttggcctccctctaccagtccttgctccac
tcagctccctccaccctcccagacttgcctttccagtacgctgacttcgcctcctggcaa
cgctcctggctcctcggccctcgcctcctctctcaactggcctggtggcgcgaacacctt
cgcggtgcccccctctctcttcacctccccaccgacttccccaggcctcccgtcctctcc
tctcgcggggcctccgtccctgttctccttccggcctctctctcccgctccctccactcc
ttgtgccttcgtgagggcgttactcccttcatggctctcatcgccgtcttccagttgctc
ctgtctcgctactccgctcaggacgacatctgcgtcggcttccccatcgccaaccgcaac
ctcccttctctcgaaggcctcatcggcttcttcgccaataccctcctcctccgctcccgc
cttcctcctgactcctccttccttcaactcctctctcaggtccgctcctcctccctcggc
gcctatgctcaccaggatgtccctttcgacaagctcgtcgaggcgatgaaccccgagcgg
gacctcagccgctctcctctcttccaggccatgttctcccttcagaacactcccgtcctc
gagctggcgcttcctgagcttgttctccaccccatggagctgcccagccagacagccaaa
ttcgaattgctcctctccctctccgaggacacggagggcttctcggggatactggagtac
aacaccgatctttttacggcggccaccatctcccagatggcagaacacttctgtgtgctg
cttgaagacgtcctcgctcatcctgagcgccgactggatcaactgtctcctctcttctct
ccagaggaacacccactcctcgtcaagcggcatgaccgagagctgccccagcaagccctg
accgaacctcctccctcctccgtcgccgccctcccgctctcttccattcacctcactctc
gtcgatatctggaaagaggtactctccctccagcatgttggcattcacgacgacttcttc
acacggggtggcaactccatctcatccatcctggtggtcgcccgcctccaagaagcaggg
ctgcacctgtcacctgatcagatcttccagaagcgaaccatcgcggaactggcgccactg
gtaacatcggctcgaaaaacggaagggcaaggcgagatcaccggggccctgccgctcacc
cccatacagcgatggttcttcgacacctgggagcagcatgcacatcacttcaaccaagcg
gtcatgctcgaggttctagaggacatcgaggccgcagtcctcgagggggcgctgcaaaag
ttactagaacaccatgatgcattgcgattgcgctttgaacgaaccggtgatggctggaga
caggagaatggtggggcaggcaggcccatcgcgctaaagcaagtggatgtctccggcctg
acacaagaagcgcagacacagaccctcgccaaagtggccgaggaagaacaagaaagcttc
gatctggcggagggccagcttctgcgagcagtgcttttccatcgcggacagggcaggacc
ggaaggctgctgttggtcattcaccatctcggggtggacgggctctcgtggcggacgctg
atcgaggatctggagaaagcgtacaagcacttgagcagtggaggtgaggcggtgcttggc
acgaagacaacatccttcaaaacatgggcagagcacctggaactctacgctgggacccag
gacgtggaggagcagctcccatattgggagaagcaagggcaggaggaagtggggccactg
ccggtcgataaggcagtgggtgccaacaccgtcgtgtcggaggaccgagtcacggtgcgg
ctagaagaagaggagacgcgagccctgctgcaagaagtgcccacggcatacgggacaagg
gtcgaagaggtgctgttggcggcactgaccgcaacgatgggaagatggacaggattggac
cggataagcgtgagcatggagggacacggccgggaagagctgttcgaggatgtggacctc
tcgagaacagtgggctggttcacatcgctgtacccaatggtcctggacactggcaaagca
gaacgccccgaagacaagctgcaagccgtgagcaaccgcctcaagggcttgcccatgaag
ggactgggttacggactgctgagatacttgggccgtgacgaaatcgtgaaaaagctggag
agattgtcctcgcccgagctgctgttcaattacttgggggagttcgacgcttcggcatcg
aggctgtcaatgttcaggcccaccagggaagagaccggtccagctcgcagtcgggaaggc
ctgcgcagccatctgctcgaagtgaacgggctcgttttcgactggaggctggagctgaca
tggagctacagccaaaaccggcacgagcgagccaccattgaaagactcgcgcaaggcttc
atgtcagaactcaggggtttcatcgatcaccagaagacggcaatcgcccacaaaaacaca
ccggcgaatgaatccctgtcggtgcggctcgagcaagtgacgcaagggctgattcacgat
cagcagatgctcggcacggcgttgctcgtcgagctagcggaccgccgtcgcgtccacatg
gccaaaggaacctcggacccggcaggcacaccctacacccagacgacccgcgtcctgatc
ggcagcctgaccaagatgtttaccgccgttgccatcctgcaactcgtagaggacggtcgg
ctctctctggatgccacagtgaatgaatggttgccttggctgatgcgcggcaaggccatc
accctccgggacctcttggcccacacgagtggcctgcctgattacctgagccggttgacc
ctgctggataccgccaagccctgctccccccggtccctcgtggagttggccgagcacgaa
cccgctgtcccgccagggcattactcgaacaccaattacatcgtgctgggcctcctcctc
gaggcgctcaccggaagcacctgggaagaggagatctcccggcgcatcctcgagcccttg
gggctcatccgcaccaccccgcttaccgaatccccacccgaagaccttgttggggcttgg
aagcgaggcgacgatggctggaaagacatccgccccgtgtggcatccctcatgcggttgg
gctgcggggggaatgatctccaccactgaggagttggtgaccttcgggcgcgccctgttt
agcggcgcgctgttcaagagcccggacacgctggcggcgatgcgctcgtacagcgtgagc
agcaccccacacatggccgtcggcgtcgagcacgaaatgggcctctgcctccacctgttc
cgcgttgcagggatcacgctggaaggacacctgggcgaacgtcccgggtactcagcagtc
ctgcttcatgaccctgaaacccaggccattgtcgcggccacggccaacacacatggagct
ctgaccgcgttcgcaggcgtcaaggccctcgaagcggtgcgccgcgccacttcatag

DBGET integrated database retrieval system