KEGG   Stigmatella aurantiaca: STAUR_5143Help
Entry
STAUR_5143        CDS       T01425                                 

Definition
(GenBank) Saframycin Mx1 synthetase B
Organism
sur  Stigmatella aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6336901..6338652)
Genome map
AA seq 583 aa AA seqDB search
MSDTLFERLAAADPQRGLHLFEDFGHRGSFLAYRAMPERIAACAEHFRAQGIQPGDRILF
PFETSEAVILSFFGLMALGAVPFSVKPYILSTPKGAYRDFLSRLSSRHGVNRILDVPSVR
SLELALVRVPLPPAGARLAGARPRVPEEDALAFVQFSSGSTAFPKGVPITWRNLHANLRM
IQNQGALCAQDRCVSWLPLYHDMGLVGGMLACMYGHCDSLLTQPMSFLMDPMGWLEFLSE
HRGTLAVIPNFAIDYTLKILNGLGAEELRELDLSALRTVYLGSEPINIANLERFTVLLAP
QGLRREAIKPCYGMAEVVLMVSCVGEEGWRVVTGPHGQPAISVGYPLSEFEVRLRTEEGR
VSGERELGQIELRSGSLAQAYYADERPLRGEEGFYPTGDLGFMQDGELFITGRLNDRIKI
NGQSYFSSDFEQAVERLAFIRSGRSAVIQAQGRVVVLAEVNGPEVLEDRSVGQRQVAAAI
LEAMGVTVALEDVLFIRYGQLPKTSSGKLQRRAITEAYEQGHIRVATSRDLRVDLLKHRA
RRLVLGSVLGARQRGERWLQSWVAWLRQGKDRLVAGVWPRPPS
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataccctcttcgagcggctcgccgcggcggatccccagcggggcctgcacctc
ttcgaggattttggccaccgcggctcgttcctcgcctaccgggcgatgcccgagcggatc
gccgcctgcgcggagcacttccgcgcccaggggatccagcccggggaccggatcctgttt
ccgttcgagacgtccgaggccgtcatcctctccttcttcggactgatggcgctgggggcg
gtgccattttcggtgaagccctacattctcagcacgcccaagggcgcctaccgggatttc
ctgtcgcgtctgtcctcacgccatggggtgaaccgcatcctggatgtgccaagcgtgcgc
tcgctggagttggccctcgtgcgtgtgccgcttccgcccgcgggggcccgcctcgcggga
gcgcgcccgcgggtgcccgaggaggacgcgctggcgttcgtgcagttttcctcgggctcg
acggcctttccgaagggggtgcccatcacctggcgcaacctccacgccaacctgcggatg
atccagaaccagggagcgctgtgcgcccaggatcggtgcgtgagctggctgccgctgtac
cacgacatggggttggtgggcgggatgctggcgtgcatgtacgggcactgcgacagcctc
ctcacccagcccatgagtttcctcatggatccgatgggctggctggagttcctgtcggag
caccgcggcaccctggccgtcattccgaacttcgcgatcgattacacgctgaagatcttg
aacggactcggggcggaggaactgcgagagctggatctgtcggcgctgcggaccgtctat
ttgggcagcgagcccatcaacatcgccaacctggagcgcttcacggtgctgcttgccccc
cagggcttgcggcgagaggcgatcaagccctgctacggcatggccgaggtggtgctgatg
gtctcgtgcgtgggggaggaggggtggcgggtcgtcacgggccctcacggacaaccggcc
atctccgtggggtatcccctgagcgagttcgaggtgaggttgcggaccgaagaaggccgc
gtcagcggggagcgcgagctgggccagatcgaactgcgaagcgggagcctggcacaggcg
tactacgcggacgagcgccccctgcgcggcgaggagggtttctaccccacgggcgatctg
ggcttcatgcaggatggggagctgttcatcacgggccgcctcaatgaccggatcaagatc
aacggccagagctacttctccagtgacttcgagcaagccgtcgagcgcctcgcgttcatc
cggtccggcagatcggcggtcatccaggcccaggggcgcgtggtggtgctcgccgaagtg
aacggcccggaggtgctggaggacaggtccgtgggccagcgtcaggtggccgccgcgatt
ctggaggcgatgggcgtcaccgtggcgttggaggacgtgctgttcatccgctatgggcag
cttcccaagacgagcagcggcaagctccagcgcagggccatcaccgaggcctacgagcag
ggacacatccgcgtggccacctcccgggatctgcgcgtggacctgctgaagcatcgggct
cggaggctcgtcctgggctcggtgctcggggcgcggcagcgtggggagcggtggctccag
tcctgggtcgcgtggctgcgccaggggaaggatcgcctcgtcgcgggggtgtggccccgt
ccgccctcctga

DBGET integrated database retrieval system