KEGG   Stigmatella aurantiaca: STAUR_7765Help
Entry
STAUR_7765        CDS       T01425                                 

Definition
(GenBank) Glycosyl hydrolase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STAUR_7765
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STAUR_7765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9494445..9496421
Genome map
AA seq 658 aa AA seqDB search
MPGEAQAQTYVHLFEWRWADVAKECETFLGPKGYTAVQVSPPNEHISGGEWWARYQPVSY
KLDSRGGTRAQFIDMVQRCNAAGVAIYADLVINHTAAGSGGTGSGGSTWSNRRHPMFSPQ
DYHSPICTISNYQDAWNVQNCDLVGLPDLNTGASYVQQTIANYVNDLTSIGVKGYRIDAA
KHMSSGDISGIKGRFTGSPYIFQEVIDLGGEAVTASQYFGNGAVTEFKYSANIGTQFKTG
QLKNLNAFGESWGFMASDRAVVFTDNHDNQRGHGAGGANVLTYKDGNLYTLANVFMLGWP
YGYPQVMSSYAFTNTDAGPPGGSVHNGSNVDCFGSAWQCEHRWRPIANMVTFRKTTQGAA
VSRWWDNGNNQVAFARTGKGFVVINREGGTLSRSFATGLPAGTYCNIITGDFANGTCSGS
TLTVDAAGNASFSVPGMTAAAIHINAKGSSGGGGGGYTKNYPQVYFRGTPNNWGVTAMTL
VANNTWRTTATFGSTTTERFKFDIYGDWTVNFGDTQRDGIAESGGGDIPIPQAGTYTLTF
NDSTLAYTAQRDSGGGGGGTVAVTFTCNNGQTVAGQSVYVVGSLAALGTWAPASAIKLTP
SSYPTWTGTVTLPASTGLEWKCLKRNETDATQGVQWQGGGNNALTTPASGTASASASF
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggaggctcaggcacaaacctatgtccacctgttcgagtggagatgggcagat
gtcgccaaggaatgcgagacattcctggggcccaagggctacaccgccgtccaggtctct
ccgcccaacgagcacatctcgggcggggagtggtgggcgcgctatcagccggtgagctac
aagctggacagccgcgggggcacccgggcgcagttcatcgacatggtccagcgctgcaac
gcggcaggcgtcgccatctacgcggacctggtcatcaaccacaccgccgccgggagcggg
gggactggctccggaggctccacctggagcaaccggcgccacccgatgttcagcccccag
gactaccactcgcccatctgcaccatcagcaactaccaggatgcctggaacgtgcagaat
tgcgatctcgtgggcctgccggacctgaacaccggcgcgagctacgtgcagcagacgatc
gccaactacgtcaatgacctgacctccattggcgtgaagggctaccgcattgacgccgcc
aagcacatgagctccggggacatctcgggcatcaagggccggttcaccggctcgccctac
atcttccaggaggtgattgatctgggcggcgaggcggtgacggccagccagtacttcggc
aatggggcggtgacggagttcaagtacagcgccaacattggcacccagttcaagacgggc
cagctcaagaacctgaatgcctttggcgagagctggggcttcatggccagcgaccgggcg
gtggtgttcaccgacaaccacgacaaccagcggggccatggcgcgggcggcgccaacgtc
ctgacctacaaggacggcaacctctacacgctggccaacgtcttcatgctgggctggccg
tatgggtacccccaggtcatgtccagctatgccttcaccaacacggatgcggggcctccg
ggcggcagcgtccacaacggctcgaacgtcgactgcttcggcagcgcctggcagtgcgag
caccgctggcggcccatcgccaacatggtgaccttccggaagacgacccagggcgcggcc
gtgtcgcggtggtgggacaacggcaacaaccaggtggccttcgcgcgcaccggcaagggt
ttcgtggtcatcaaccgcgagggcggcacgctcagccgctccttcgccacgggcctgccc
gctggcacctactgcaacatcatcaccggtgacttcgccaatggcacgtgctcggggagc
accctcacggtggatgcggccggcaacgcgtccttcagcgtgccgggcatgacggcggcc
gccatccacatcaacgccaagggcagcagcggaggcggagggggtggctacaccaagaac
tatccccaggtgtacttccggggcacccccaacaactggggggtcacggccatgacgctg
gtggccaacaacacctggaggaccacggccaccttcgggagcaccaccaccgagcgattc
aagttcgacatctacggggactggacggtgaacttcggcgatacccagagggacggcatc
gcagagagcggcggcggcgacatccccatcccccaggcgggcacctacaccctcaccttc
aatgacagcaccctcgcctacaccgcgcagcgcgactccggaggaggtggcggaggcacc
gtggccgtcaccttcacctgcaacaacgggcagaccgtggcgggccagagcgtctacgtg
gtgggcagcctcgctgcgctgggcacctgggcgcccgcgagcgccatcaagctcacgccg
tcgagctatcccacgtggaccggcaccgtcaccttgccggcgagcacgggccttgagtgg
aagtgcctcaagcgcaacgagaccgatgcaacccagggcgttcagtggcaggggggtggc
aacaacgcgctcaccaccccggcctcgggaacggcctccgcctcggccagcttctag

DBGET integrated database retrieval system