KEGG   Sporosarcina ureae: SporoP32a_01370Help
Entry
SporoP32a_01370   CDS       T04877                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sure  Sporosarcina ureae
Pathway
sure00010  Glycolysis / Gluconeogenesis
sure00071  Fatty acid degradation
sure00350  Tyrosine metabolism
sure00625  Chloroalkane and chloroalkene degradation
sure00626  Naphthalene degradation
sure01100  Metabolic pathways
sure01110  Biosynthesis of secondary metabolites
sure01120  Microbial metabolism in diverse environments
sure01130  Biosynthesis of antibiotics
sure01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sure00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SporoP32a_01370
  Lipid metabolism
   00071 Fatty acid degradation
    SporoP32a_01370
  Amino acid metabolism
   00350 Tyrosine metabolism
    SporoP32a_01370
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SporoP32a_01370
   00626 Naphthalene degradation
    SporoP32a_01370
Enzymes [BR:sure01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SporoP32a_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 IGFBP 3HCDH_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: ARK23028
UniProt: A0A1W6F4T9
LinkDB All DBs
Position
complement(270502..271515)
Genome map
AA seq 337 aa AA seqDB search
MKAAIVKEFQTKLQIEDTAKPVPGPGQALVKLEACGVCHTDLHAINGDWPVKPKLPLIPG
HEGVGIVEAIGPNVTAVKIGDRVGIPWLYSACGECDYCLQGKETLCHKQENGGYSVDGGY
AEYCLAAAEYVAKIPENLSSVEAAPILCAGVTTYKALKVSGAKPGDWVAIYGIGGLGHVA
LQYAKAMGFNVVAVDIADEKLELAKNLGADIAINGRKEDPAEAIQQQVGGVQAAISVAVS
KVPFEQAYRSIKRGGTLVAVGLPHEELPIPIFNTVLNGVTVKGSIVGTRIDMKEALDFAA
RGKVKAQIETAPLSEVNEVLDKMEAGKINGRIVLTFD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaatcgtaaaagaatttcaaacaaaactacaaatcgaggacacggcaaag
cctgtaccaggtccgggtcaagctttagtaaaattggaagcatgtggtgtttgtcataca
gacttgcatgcgataaacggagactggcccgttaaaccgaaactacctctcattcccgga
cacgaaggcgtcggtattgtcgaagcgatcggtccgaatgttactgcggtaaaaataggg
gatcgtgtagggattccttggctgtattcggcatgtggagaatgtgattattgtctacaa
ggaaaagaaactctttgccacaagcaggagaacggcggctattcagttgatggcggatat
gcggaatattgcttggcggcggcagagtatgtagccaaaattcctgagaatcttagctca
gttgaagcagctcctattctttgtgcgggtgtgacaacgtataaagcattgaaagtatcg
ggtgcgaagccaggggactgggttgcgatttacggtattggtggcctaggtcatgtcgcg
ttgcaatacgcaaaggcgatgggctttaacgtagtcgcagtcgatattgcggatgagaaa
ctagaacttgcgaagaatctaggcgctgatatcgcaataaatggacggaaagaagatcct
gctgaagcgatccaacaacaagtaggcggagtacaagcagcgatcagtgtagcggtttcc
aaagtaccatttgagcaggcataccgttccattaaacgtggcggaacattagtagcagtc
ggactaccgcacgaggaactgcctattcccattttcaacacagtattaaatggcgtaacg
gtaaaaggatcgatcgtcggcacacgcatcgacatgaaagaagcacttgatttcgctgcg
cgcggaaaagtaaaagcccagatcgaaacagcgcctctttctgaagtgaatgaagtgttg
gataaaatggaggcagggaagatcaacggacgtattgttttaacgtttgattaa

DBGET integrated database retrieval system