KEGG   Candidatus Solibacter usitatus: Acid_7662Help
Entry
Acid_7662         CDS       T00412                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00250  Alanine, aspartate and glutamate metabolism
sus00410  beta-Alanine metabolism
sus00640  Propanoate metabolism
sus00650  Butanoate metabolism
sus01100  Metabolic pathways
sus01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Acid_7662
   00650 Butanoate metabolism
    Acid_7662
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acid_7662
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Acid_7662
Enzymes [BR:sus01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Acid_7662
Amino acid related enzymes [BR:sus01007]
 Aminotransferase (transaminase)
  Class III
   Acid_7662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABJ88561
JGI: Acid7662
UniProt: Q01P59
LinkDB All DBs
Position
complement(9622312..9623622)
Genome map
AA seq 436 aa AA seqDB search
MTKEEIILANKEFLFPAVFHFYKEPLVIARAKDQYVWDADGNQYLDFLGGIVTVSVGHCN
DQVNAKVHKQLDTLQHVSTLFANEPQAALAKKIASITPGGKLTKSFFTNSGTEANETAIL
TARCYTGSTEIVALRHSYHGRSAMAMTLTGQGTWRLGPAQSGVIHAHNAYCYRCPFGLTY
PTCDVRCAQDMEELIRSTTGGQIAGFIAEPIQGVGGFITPPKEYFQIVEKIVRNHGGLFI
SDEVQTGWGRTGGKWFGIEQWGVTPDIMTGAKGLGNGSPVGLTVAKPEVADGLKGVTLST
FGGNPVTATAAKAVIDYIEEQRLMDNCTQTGGYLRARLEELKEKHEIIGDVRGMGLMQAI
ELVDDRASKTPATAATARLIESTKEHGLIVGKGGMYGNVIRVTPPMNIAKTDVDNFIELL
DKSLVACGAMAAGGVK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagaaatcattcttgccaataaagagtttctcttcccggcggtcttccat
ttctacaaagaaccgctggtgatcgcgcgtgccaaggaccaatacgtctgggacgccgac
ggcaaccagtacctggatttcctgggcggcatcgtgaccgtgagcgtgggccactgcaac
gaccaggtgaatgccaaagtccacaagcagctcgataccctgcagcacgtttccactctc
ttcgccaatgagccccaggccgcgctggcgaaaaagatcgcctccatcacgcccggcggc
aagctcaccaagagcttcttcaccaacagcggcaccgaagccaacgagaccgcgatcctg
accgcccgctgctacacgggcagcaccgaaatcgtcgccctccgccattcctatcacggc
cgctccgcgatggccatgaccctcaccggccaaggcacgtggcgcctcggccccgcgcaa
tccggcgttatccatgcgcacaacgcctactgctatcgctgcccctttggtctgacctat
cccacctgcgacgtccgctgcgcgcaggatatggaagagctcatccgcagcaccaccggc
ggacagatcgccggcttcatcgccgagccgatccaaggcgtcggcggcttcatcaccccg
cccaaagagtacttccagatcgtcgaaaagatcgtccgcaatcacggcgggctgttcatc
agcgatgaagtgcagaccggctggggacgcaccggcggcaagtggtttggcatcgagcag
tggggcgtcacgcccgacatcatgaccggggccaagggcctcggcaacggcagcccggtt
ggcctcaccgtggccaaaccagaagtcgccgacggactcaagggagtgacactttccacc
ttcggcggcaatccggtcactgccaccgccgctaaagcggtcatcgactatatcgaagag
cagcgcctgatggacaactgcacccagaccggcggctacctgcgcgcccgcctcgaagag
ctcaaagagaaacacgaaatcatcggcgacgtccgcggcatgggcctgatgcaggccatc
gagctggtggacgatcgcgcgagcaaaacgccggcgactgcggccaccgcgcgcctcatc
gaatccaccaaggagcacggccttatcgttggcaagggcggtatgtacggcaacgtgatc
cgcgtcacgccgcccatgaacatcgccaaaaccgacgtggacaacttcatcgagctgctg
gataagagcctggtggcctgcggagcgatggcggccgggggcgtcaagtga

DBGET integrated database retrieval system