KEGG   Staphylococcus aureus 04-02981: SA2981_2062Help
Entry
SA2981_2062       CDS       T02070                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
suy00010  Glycolysis / Gluconeogenesis
suy00053  Ascorbate and aldarate metabolism
suy00071  Fatty acid degradation
suy00280  Valine, leucine and isoleucine degradation
suy00310  Lysine degradation
suy00330  Arginine and proline metabolism
suy00340  Histidine metabolism
suy00380  Tryptophan metabolism
suy00410  beta-Alanine metabolism
suy00561  Glycerolipid metabolism
suy00620  Pyruvate metabolism
suy00625  Chloroalkane and chloroalkene degradation
suy01100  Metabolic pathways
suy01110  Biosynthesis of secondary metabolites
suy01120  Microbial metabolism in diverse environments
suy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2981_2062
   00053 Ascorbate and aldarate metabolism
    SA2981_2062
   00620 Pyruvate metabolism
    SA2981_2062
  Lipid metabolism
   00071 Fatty acid degradation
    SA2981_2062
   00561 Glycerolipid metabolism
    SA2981_2062
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA2981_2062
   00310 Lysine degradation
    SA2981_2062
   00330 Arginine and proline metabolism
    SA2981_2062
   00340 Histidine metabolism
    SA2981_2062
   00380 Tryptophan metabolism
    SA2981_2062
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SA2981_2062
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SA2981_2062
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SA2981_2062
Enzymes [BR:suy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SA2981_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADC38273
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2192216..2193643)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system