KEGG   Saccharomonospora viridis: Svir_18360Help
Entry
Svir_18360        CDS       T00980                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
svi  Saccharomonospora viridis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1906637..1908370
Genome map
AA seq 577 aa AA seqDB search
MRENGDPSRGSESTLVSAVSRWAEIDAERPALFFVRDPENAAANDSLTYGQLYEKACAVA
GWLKNNLPRGSRVLLLYPQGIEFAVAFLGCLRAGMIAVPAPLPTGRDQEDRRIEGIAKDS
GAVVVMTSRNGAEAVGRWLRDTGSCRLDSFVTDDAEPSPGIEEWGSEPVDPDSLAVLQYT
SGSTNAPKGVMVSHRAMHVSVTNQISALCLESGMRMGGWLPLYHDMGLLATLAPALFLGS
SCVLLDVRTFLKRPISWLKLIDRFDVAFSAAPNFAYEMCCKRISDEELSGLDLSRWRYVV
SGSEPIQAETMRRFARRFAAVGLDVDALVPAYGLAETVVFVSAANGLRTRSMGDEREVVG
CGPVEGLEAVIVDPVTMTQRPDGQTGELLLRGSSVCAGYWQNEAATEETFRVEVPGRGTG
WLRTGDLAALWEGELFLVGRIKETLIVHGRNVHPHDLEYEVRLHHPELGHVGAAFAVRAS
DGGAEQVILTHEVSDSVPRERLPDLAVAMRRTVARELGITVAGVGLLPKGGVLRTTSGKV
RRLSMRKLFCDGTLEHVYLDRGARELFGARRRNASTT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagaatggtgatccttcgagagggtcagaatctacgctcgtgtcggcggtttcc
cggtgggcggaaatcgacgccgaacggccagccttattcttcgtcagagatccggaaaac
gccgccgcgaatgattcgctgacttacgggcagctctatgaaaaagcgtgcgcagtggcg
ggatggttgaaaaacaacctgccgcggggttcccgtgtcctgctgctgtatccgcagggg
attgagttcgccgtcgcgttcctgggctgtctgcgtgccggcatgatcgcggtgcctgca
cccctgccgaccggccgtgaccaggaagatcgtcggatcgagggcatcgcgaaagactcc
ggtgccgtcgtcgtgatgacttcccggaacggggccgaagcggtcggtcgctggttgcgt
gacacaggctcctgtcggttggattcgttcgtcacggacgatgcggaaccgtcgcccggt
attgaggaatgggggagtgaaccggtcgacccggattcgttggccgtgcttcagtacacc
tccggatcgaccaatgcgccgaaaggcgtcatggtcagtcaccgggccatgcacgtcagc
gtgacgaaccagatatccgccctttgtctcgagtcgggaatgcgcatgggcggctggctc
ccgctttatcacgacatgggtttgctggccactctggcgccggcgttgttcctcggttcg
tcctgcgtcctgctcgacgttcgaacttttttgaaacggcctatctcgtggttgaaactc
attgatcggttcgacgtggcgttctccgcggcaccgaatttcgcctacgagatgtgctgt
aagcggatctccgacgaggagttgtccgggctcgacctctcccgatggaggtacgtggtc
agcggctcggagcccatccaagcggagacgatgcggcgattcgcgcgtcgtttcgccgcc
gtcgggttggacgtggacgccctggtgcccgcatacggacttgcggagacggtcgtcttc
gtgtccgctgcgaacggactgcgcaccaggtcgatgggagacgagcgtgaggtggtcggt
tgcggccccgtcgaggggttggaggccgtgatcgtcgaccccgtgaccatgacccagcgg
ccagatgggcagaccggcgaattactgctgcgcggatcgagcgtgtgcgcgggttactgg
cagaacgaggccgctacggaggagacgttccgggtggaggtacccggacgcggaaccggg
tggctgcgtaccggtgacctggcggcgctgtgggaaggggagctgttcctcgtcggccgg
atcaaggagaccctgatcgtgcacggccgcaatgtgcatccccacgacctcgagtacgag
gtgcggctgcatcatccggagctcggccacgtgggcgcggccttcgccgtccgcgcgagc
gacggtggcgccgaacaggtgatcctcacgcacgaggtgtccgactcggtgccccgggaa
cggttaccggacctggccgtcgccatgcgccggaccgtggcgcgggaactcgggatcacg
gtcgccggcgtcggcttgctgccgaaaggcggtgtactcaggaccaccagcggaaaggtc
cgcaggctctcgatgcgaaagctgttctgtgacggcacgttggagcacgtctacctcgat
cgaggtgcccgggaactgttcggcgcgagacggcggaatgcgagcacgacgtga

DBGET integrated database retrieval system