KEGG   Streptomyces violaceusniger: Strvi_1164Help
Entry
Strvi_1164        CDS       T01602                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
svl  Streptomyces violaceusniger
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Strvi_1164
  Energy metabolism
   00680 Methane metabolism
    Strvi_1164
Enzymes [BR:svl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Strvi_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
992586..995306
Genome map
AA seq 906 aa AA seqDB search
MSSADHTNAALRADIRRLGDLLGETLVRQEGPDLLELVERVRALTRSDGEAAADLLGSTD
LQTAAKLVRAFSTYFHLANVTEQVHRGRELRTRRAAEGGILARTADQLKDADPEHLRQTV
AHLGVRPVFTAHPTEAARRTVLTKLRRIAELLDTLAVGGDARRADLRLAENIDLLWQTDE
LRVARPEPADEARNAIYYLDELHAGAVGDVLEDLTAELMRVGVELPATTRPLTFGTWIGG
DRDGNPNVTPEVTRDVLILQHEHGITDALEIIDDLRAALSSSIRNTGASEELLASLQRDL
ELLPEISPRYKRLNAEEPYRLKATCMRQKIVNTRERLAGDTPHQPGRDYLGSGELLADLH
LIQDSLRAHRGHLIAGGRLERAIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLGEES
WRYADMPRDYRRKLLAKELRSRRPLAPSPAPLDAAGAKTLGVFRTIRDSFERFGPEIVES
YIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTEELKIADKLLDEMLADP
SYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLRDVAHRHGVRLRLFHGRG
GTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAATLQAS
ALHTAPRQSDEALARWDGAMETVSDAAHGAYRALVDDPDLPAYFFASTPVDQLADLHLGS
RPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKAAREAGLDGVLDEMHQHW
HFFRNFLSNVEMTLAKTDLRIARHYVDTLVPEDLKHVFDVIQEEHELTVREVLRITGGRE
LLDSNPVLKQTFHVRDAYLDPISYLQVTLLHRQRTARERGEEPDPLLGRALLLTVNGVAA
GLRNTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccacaccaacgccgctctgcgtgccgacatccgccgtctgggggac
ctgctcggcgagacgctcgtccgccaggagggacccgacctcctcgaactcgtcgagcgc
gtccgcgccctcacccgcagtgacggcgaggccgccgccgacctgctcggctccaccgac
ctccagaccgccgccaagctggtccgcgccttctccacctacttccacctggccaacgtc
accgaacaggtacaccgcggccgcgagctgcgcacccgccgcgccgccgagggcggcatc
ctcgcccgcaccgccgaccagctcaaggacgccgaccccgagcacctccggcagaccgtc
gcccacctcggcgtccgccccgtcttcaccgcccaccccaccgaggccgcccgccgcacc
gtcctcaccaagctccgccgtatcgccgaactgctcgacaccctcgccgtcggcggcgac
gcccgccgcgccgacctgcggctcgccgagaacatcgacctgctctggcagaccgacgag
ctgcgcgtcgcccgccccgaacccgccgacgaggcccgcaacgccatctactacctcgac
gaactgcacgccggcgccgttggcgacgtcctcgaggacctcaccgccgaactgatgcgc
gtcggcgtcgagctgcccgccaccacccgccccctcaccttcggcacctggatcggcggc
gaccgcgacggcaaccccaacgtcacccccgaggtgacccgcgacgtcctgatcctccag
cacgaacacggcatcaccgacgccctggagatcatcgacgatctgcgtgccgccctctcc
agctccatccgcaacaccggcgcctccgaggaactcctcgcctccctccagcgcgacctc
gaactgctgcccgagatcagcccgcgctacaagcggctcaacgccgaagagccctaccgg
ctcaaggccacctgcatgcggcagaagatcgtcaacacccgcgaacggctcgccggcgac
accccccaccagcccggccgcgactacctcggctccggtgaactcctcgccgacctccac
ctcatccaggactccctgcgcgcccaccgcggccacctcatcgccggcggccggctcgaa
cgcgccatccgcaccctcgccgccttcggcctccagctcgccaccatggacgtccgcgaa
cacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggcgaggaatcc
tggcgctacgccgacatgccgcgcgactaccgccgcaagctgctcgccaaggaactgcgc
tcccggcgccccctcgcccccagcccggcccccctcgacgccgccggcgccaagaccctc
ggcgtcttccgcaccatccgcgactccttcgagcgcttcggccccgaaatcgtcgagtcc
tacatcatctccatgtgccagggctccgacgacgtcttcgccgccgccgtcctcgcccgc
gaggccggactgatcgacctccacgccggctgggccaagatcggcatcgtcccgctgctg
gagaccaccgaagaactcaagatcgccgacaagctcctcgacgaaatgctcgccgacccc
tcctaccggcggctcgtcgccctccgcggcgacgtccaggaggtcatgctcggctactcc
gactcctccaagttcggcggcatcaccacctcccagtgggagatccaccgcgcccagcga
ctgctgcgcgacgtcgcccaccggcacggcgtacggctgcggctcttccacggccgcggc
ggcaccgtcggccgcggcggcggccccacccacgacgcgatcctcgcccagccgtggggc
accctcgaaggcgagatcaaggtcaccgaacagggcgaggtcatctccgacaagtacctc
gtgccctcgctcgcccgcgagaacctggaactcaccgtcgccgccacgctgcaggcatcc
gccctgcacaccgcgccccgccagtccgacgaggcgctcgcccgctgggacggggccatg
gaaaccgtctccgacgccgcccacggcgcctaccgcgcactcgtcgacgaccccgacctg
cccgcgtacttcttcgcctccaccccggtcgaccagctcgccgacctccacctcggctcc
cggccctcccgccgccccgactccggcgcgggcctcgacggactccgggccatcccctgg
gtgttcggctggacccagtcccggcagatcgtccccggctggttcggcgtcggctccggc
ctcaaggccgcccgcgaagccggactcgacggcgtcctcgacgaaatgcaccagcactgg
cacttcttccgtaacttcctgtccaacgtcgaaatgaccctggccaagaccgatctgcgg
atcgcccggcactacgtcgacacgctggtccccgaggacctcaagcacgtcttcgacgtc
attcaggaagaacacgaactgacggtgcgggaggtactgcgcatcaccggcgggcgcgaa
ctcctcgactccaacccggtgctgaagcagaccttccacgtccgggacgcctacctcgac
ccgatctcgtacctgcaggtgaccctgctccaccgccagcgcaccgcgcgtgaacgaggc
gaggagcccgacccgctgctcggccgcgcgctcctcctcacggtcaacggggtcgcggcg
ggcctccgcaacacgggctga

DBGET integrated database retrieval system