KEGG   Streptomyces violaceusniger: Strvi_3581Help
Entry
Strvi_3581        CDS       T01602                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3752678..3753739
Genome map
AA seq 353 aa AA seqDB search
MPPVEPMLAKAVATIPPGMRYEGKWDGFRAIVFRDGDEIEISSRTTKPLTRYFPELAEAL
LANLPPRCVLDGEIIIVRGGRLDFDALLERIHPADSRVRLLAKNTPSSFVAFDILALGDA
SLMDTPLRERREALTEALRGARDPVHLAPCTDDLDMARQWFEQYEGAGLDGVVAKSPDLR
YRPGERVMVKVKHERTADCVVAGYRVHKSGQGVGSLLLGLYDDKGRLQHVGVSAAFTARR
RQELLEELEPLRMETVEGHPWADWAREEAHAKGRMPGAPSRWTGVKDLSWTPVRPERVCE
VAYDHMQGGRFRHTARFRRWRPDREPEQCTYDQLEEPVSYDLRQVLGSSAADA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccgtcgagccgatgctggccaaggccgtggccacgatcccgcccgggatgcgt
tacgagggcaaatgggacggcttccgggccatcgtcttccgcgacggggacgagatcgag
atcagtagccgcaccaccaagccgctcacccgctacttccccgagctggccgaggcgctg
ctcgccaacctcccgccgcgctgcgtcctggacggcgagatcatcatcgtgcgcggcgga
cggctggacttcgacgccctgctggagcggatccaccccgccgactcccgggtgcggctg
ctggcgaagaacacgccgtcaagctttgtcgccttcgacatcctcgccctcggggacgcc
tcgctgatggacaccccgctccgcgagcgccgcgaggcgctgaccgaggcgctgcgcggc
gcccgggacccggtgcacctcgccccctgcaccgacgatctcgacatggcccggcagtgg
ttcgagcagtacgagggggccgggctcgacggcgtcgtggccaagagccccgacctgcgc
taccgccccggcgagcgcgtgatggtcaaggtcaagcacgagcgcaccgccgactgtgtg
gtggccgggtaccgcgtccacaagtcaggccagggcgtcggctcgctgctgctcggcctg
tacgacgacaagggccgcctccagcacgtgggcgtcagcgccgccttcaccgcgcgccgc
cgccaggagctgctggaagagctggagcccctgcgcatggagaccgtcgaaggccacccc
tgggccgactgggcgcgcgaggaggcccatgccaagggccggatgccgggcgcgcccagc
cgctggaccggggtcaaggatctgtcctggacgccggtgcgccccgagcgggtgtgcgag
gtggcctacgaccacatgcagggcggccgcttccggcacaccgcccgcttccggcgctgg
cggccggaccgggagcccgagcagtgcacctacgaccagcttgaggagccggtctcctac
gatctgcgccaggtgctggggtcgtccgccgcggacgcgtag

DBGET integrated database retrieval system