KEGG   Shewanella violacea: SVI_2322Help
Entry
SVI_2322          CDS       T01206                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
svo  Shewanella violacea
Brite
Enzymes [BR:svo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SVI_2322
Peptidases [BR:svo01002]
 Metallo Peptidases
  Family M2
   SVI_2322
Exosome [BR:svo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SVI_2322
CD molecules [BR:svo04090]
 Proteins
  SVI_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2661918..2663756
Genome map
AA seq 612 aa AA seqDB search
MSLLMPKLSRLSLLIALSIGVSACNSSKNDDSNSASSKTSEAKQFLIQSEQTLSDLSIEI
NRAEWIYSNFITDDTAALSASAAEKLTATSVRLATQAAQYTDLALDDTSLRKLNILRSSL
VLPAPLDPEKNAELAGISAQLNGLYGKGKYCFDDGRCLTQPELSAIMAESSDPKLLLEVW
QGWREIAKPMRPLFQREVELANEGAKDLGYADLSVLWRSQYDMKPDEFSNELDRLWGQVK
PLYDSLHCYVRGELNEEYGDEVVPANGPIPAHLLGNMWAQSWGNVYDKVSPQDADPGYDL
TQLLAEHDYDEVKMVKQAESFFSSLGFDELPDSFWERSLFVQPKDRDVVCHASAWDLDNL
DDIRIKMCIQKTAEDFTVIHHELGHNYYQRAYKNQPFIFKNSANDGFHEAIGDTIALSIT
PSYLKQIGLLDEVPDASKDIGLLLKQALDKVAFMPFGLMIDQWRWKVFSGEITPDQYNQA
WWDLREKYQGVKAPIERSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHKSLCETAGDT
GPVHRCSIYGNKAAGSKLNTMLEMGLSRPWPDALKVVTGSPEMDASAVLDYFAPLQVWLN
EQNTQAKRQCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttctaatgccgaaactttcacgtctttcgctgctcattgcgctttcaataggg
gtatctgcctgtaattcctctaaaaatgacgatagtaactcagcttcatctaaaacttca
gaggctaaacaattcctaatacaatctgagcaaacattgagcgatctttccatcgagatt
aatcgtgccgaatggatctacagcaatttcattaccgatgatacggcggccctctcagcg
tcagcggctgaaaaactcaccgcaacctcggtgagactcgcgactcaagccgctcaatat
accgatttagcactggatgatactagtctgcgtaaactcaatatattacgcagttctttg
gtactccccgcccctctcgaccctgaaaaaaatgccgagcttgccggaataagtgcacag
ctcaatggattgtacggtaaaggaaaatattgtttcgatgacggtcgctgtttaactcaa
cccgagctgtcagcaatcatggctgaatccagtgaccctaaattattactcgaagtgtgg
caaggttggcgtgaaatagctaaacctatgcgtcctctgtttcagcgtgaagttgaatta
gccaatgaaggcgctaaagatctgggctacgccgatttgtctgtattatggcgcagtcaa
tatgacatgaaacccgatgaattctccaatgaactggacaggctatggggtcaagttaag
cctctatatgattcattacactgttatgtccgcggcgaactcaatgaagagtatggcgat
gaagtcgtaccggccaatgggccgattccggctcatttactgggtaacatgtgggcgcag
agttggggcaatgtctatgataaagtctcacctcaagatgcagatccgggttatgacttg
actcagcttcttgccgagcatgactatgatgaagtcaaaatggttaaacaagccgaaagc
ttcttcagctcactgggtttcgatgagctaccagattcattctgggagcgatctttgttc
gtccaacctaaagatcgcgatgtagtgtgtcatgcatctgcctgggatctggataacctg
gatgatatacggatcaagatgtgtattcagaaaacggctgaagattttaccgttatccat
catgagttaggtcacaactattaccaacgtgcctataaaaaccagccatttatcttcaaa
aatagtgctaatgatggctttcatgaggctataggtgacacgattgcattatctatcacc
ccaagttacctgaaacagataggtttactcgatgaagtccctgatgcatcgaaagatatc
ggcctattactcaagcaagcattagataaagttgcctttatgcccttcggcttgatgatc
gatcagtggcgctggaaagtgttcagtggtgaaatcaccccggatcagtacaaccaagcc
tggtgggatctaagagagaaatatcagggagtgaaggcccccatcgagagaagtgaagct
gattttgaccctggtgctaaataccatgtaccaggaaatgtcccttatacgcgttatttc
ttagcccacattttacagttccaattccacaagtccctgtgtgagactgccggtgataca
gggccagttcatagatgtagtatttatggcaataaagcagcaggcagtaaactcaatacc
atgttagaaatgggactgagccgtccatggcctgatgcattaaaagtggtcactggtagc
cctgagatggatgctagcgccgtgctcgattacttcgctccgttacaagtttggttaaat
gagcaaaacactcaagcaaagcgccaatgtggatggtga

DBGET integrated database retrieval system