KEGG   Streptomyces vietnamensis: SVTN_23220Help
Entry
SVTN_23220        CDS       T03586                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00564  Glycerophospholipid metabolism
svt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SVTN_23220
Enzymes [BR:svt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SVTN_23220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 DUF5069 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJF66860
UniProt: A0A0B5HY34
LinkDB All DBs
Position
5133085..5134791
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERAEALAAMAERELDVLVVGAGVVGAGTALDAVTRGLSTGIVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERFY
AGSGVALYDAMSLSSGHGRGLPAHRHLSRKGALRVAPCLRKDALVGALQYYDAQMDDARF
VTTLVRTAASYGARAASRARVTGFLREGERVVGARVQDVEAGEAYEIRAKQIVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNTVLATPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAQDAVDAAVHGLDQRVAPCVTEDTPLLGAEGYRAL
WNARARIAARTGLHVVRVEHLLNRYGSLTEEILDLIAADPSLGEPLAAADDYLRAEILYA
ASHEGARHLDDVLTRRTRISIETFDRGTLSARECAELMAPVLGWDDRQIEKEVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgccgagcgcgccgaggcgctcgcggccatggccgag
cgagagctggacgtgctggtcgtcggcgccggagtggtcggcgcgggaaccgccctcgac
gccgtcacgagagggctctccaccggcatcgtcgaggcccgcgactgggcctcgggcacc
tccagcaggtccagcaagctcatccacggcggcctgcgctacctggagatgctggacttc
gccctcgtacgggaggcgctcaaggagcgcggactcctcctggagcggctcgccccccac
ctggtgaagccggtccccttcctctaccccctccagcacaagggctgggagcggttctac
gccggctcgggcgtcgccctgtacgacgcgatgtcgctctcctcgggacacggccggggg
ctccccgcccaccggcacctctcccgcaagggcgccctgcgcgtcgcgccctgcctgagg
aaggacgccctggtcggcgccctgcagtactacgacgcccagatggacgacgcccgcttc
gtcaccaccctcgtgcgcaccgccgcctcctacggcgcgagggccgccagccgggcccgc
gtcaccggcttcctccgcgagggcgagcgggtcgtcggcgcgcgcgtccaggacgtcgag
gccggggaggcgtacgagatcagggccaagcagatcgtcaacgccaccggcgtgtggacg
gacgacacccaggccctcatcggggagcgcggccagttccacgtccgcgcctccaagggc
atccacctcgtcgtgcccaaggaccgcatccactcgaccaccggactgatcctgcgcacc
gagaagtccgtcctgttcgtcatcccctggggacgccactggatcgtcggcaccaccgac
accgactgggacctcgacaaggcccaccccgccgcctccagcgccgacatcgactacctc
ctggagcacgtgaacaccgtgctcgccaccccgctcacccgggacgacgtccagggcgtc
tacgccgggctgcggcccctcctcgccggcgagtcggacgccaccagcaagctctcccgg
gagcacaccgtcgcccacccggtccccggcctcgtggtcgtcgccggcggcaagtacacg
acgtaccgcgtgatggcgcaggacgccgtcgacgcggcggtgcacggactcgaccagcgg
gtcgccccctgcgtcaccgaggacaccccgctcctcggcgccgagggctaccgcgccctg
tggaacgcgcgggccaggatcgccgccagaaccggcctgcacgtcgtcagggtcgagcat
ctcctcaaccgctacggctccctgacggaggagatcctcgacctgatcgcggccgacccg
agcctcggcgaaccgctcgcggcggccgacgactacctgcgcgccgagatcctgtacgcc
gcctcgcacgagggcgcgcgccacctcgacgacgtcctcacccggcggaccaggatctcc
atcgagaccttcgaccggggcacgctcagcgcccgcgagtgcgcggagctgatggcgccg
gtcctcggctgggacgaccggcagatcgagaaggaggtcgagcactacgagaagcgggtg
gaggcggagcgcgagtcgcagcggcagcccgacgacctgacggcggacgccgcgcggctc
ggggcgccggacatcgtgcccatctga

DBGET integrated database retrieval system