KEGG   Streptomyces vietnamensis: SVTN_27440Help
Entry
SVTN_27440        CDS       T03586                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
svt  Streptomyces vietnamensis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:svt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVTN_27440
   00650 Butanoate metabolism
    SVTN_27440
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVTN_27440
   00280 Valine, leucine and isoleucine degradation
    SVTN_27440
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVTN_27440
Enzymes [BR:svt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SVTN_27440
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SVTN_27440
Amino acid related enzymes [BR:svt01007]
 Aminotransferase (transaminase)
  Class III
   SVTN_27440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6078419..6079753)
Genome map
AA seq 444 aa AA seqDB search
MNAVPQERRVVTAIPGPKSQELQARRLDTVAGGVGSTLPVFTARAGGGIIEDVDGNRLID
FGSGIAVTSVGASAEAVVRRASAQLQDFTHTCFMVTPYEGYVEVCEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARSYTKRQAVVVFDHGYHGRTNLTMGMTAKNMPYKQGFGPFAPE
VYRVPVAYGYRWPTGAENCGPEAAAQAIDNITKQIGAENVAAIVIEPVLGEGGFIEPAKG
FLPAIVKFANDNGIVFVADEIQAGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDSVHGGGLGGTYGGNPVACAGALGSIETMKELDLNGKAKRIEEVMKGRLTAMQE
KFPVIGDIRGRGAMIAIELVKDPATKEPAPEAAAALAKYCHNEGVLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDVIEAALASI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgtcccgcaggagcggcgcgtcgtcaccgccatccccggtccgaagtcgcag
gagcttcaggcccgccgtctcgacacggtcgccggtggcgtcggctccacgctgcccgtc
ttcaccgcgcgggccggcggcggcatcatcgaggacgtcgacggcaaccgtctgatcgac
ttcggctccggcatcgccgtgacctcggtcggcgcctccgccgaggccgtcgtgcgccgc
gcctccgcgcagctgcaggacttcacccacacctgtttcatggtcacgccgtacgagggc
tacgtcgaggtctgcgaggccctcgccgagctgaccccgggcgaccacgccaagaagtcc
gcgctgttcaactcgggcgccgaggccgtcgagaacgcggtgaagatcgcccgctcgtac
accaagcgccaggccgtcgtcgtcttcgaccacggctaccacggccgtaccaacctcacc
atgggcatgacggcgaagaacatgccgtacaagcagggcttcggcccgttcgcgcccgag
gtctaccgcgtgccggtcgcctacggctaccgctggcccaccggcgcggagaactgcggc
ccggaggccgccgcccaggcgatcgacaacatcaccaagcagatcggcgccgagaacgtc
gccgcgatcgtcatcgagccggtcctcggcgagggcggcttcatcgagccggccaagggc
ttcctgccggcgatcgtgaagttcgccaacgacaacggcatcgtcttcgtcgcggacgag
atccaggccggcttctgccgtaccggccagtggttcgcctgcgaggacgagggcatcgtc
ccggacctcatcaccaccgccaagggcatcgcgggcggtctgccgctcgccgccgtcacc
ggccgcgccgagatcatggactccgtccacggcggcggtctgggcggcacctacggcggc
aacccggtcgcgtgcgccggtgcgctcggctccatcgagacgatgaaggagctcgacctc
aacggcaaggccaagcgcatcgaggaggtcatgaagggccgcctcaccgccatgcaggag
aagttcccggtcatcggtgacatccgtggccgcggcgccatgatcgccatcgagctggtg
aaggacccggcgacgaaggagccggcgccggaggccgccgccgcgctcgccaagtactgc
cacaacgagggcgtgctcgtcctgacctgcggcacctacggcaacgtgctgcgcttcctg
ccgccgctggtcatcggcgaggacctgctcaacgagggtctggacgtcatcgaggccgcg
ctcgcgtccatctga

DBGET integrated database retrieval system