KEGG   Streptomyces vietnamensis: SVTN_30620Help
Entry
SVTN_30620        CDS       T03586                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
svt  Streptomyces vietnamensis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:svt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVTN_30620
   00650 Butanoate metabolism
    SVTN_30620
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVTN_30620
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVTN_30620
Enzymes [BR:svt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SVTN_30620
Amino acid related enzymes [BR:svt01007]
 Aminotransferase (transaminase)
  Class III
   SVTN_30620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6813714..6814997
Genome map
AA seq 427 aa AA seqDB search
MTSLYARHKAVIPDWVALYYRDPLEITHGEGRHVWDAEGRKYLDFFGGILTTMTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERVAGLSGIPDARVFFTTSGTEANDTALLLAT
AYRRSNQILAMRNSYHGRSFSTVGITGNRTWSTTGLSPLQTLYVHGGVRGRGPYAGLTDE
RFIEACVADLEDVLGQTRAGVAALIAEPIQGVGGFTSPPDGLYAAFRRVLDRHGILWISD
EVQTGWGRTGDHFWGWQAHGQAGPPDILTFAKGIGNGMSVGGVVARAEIMNCLDASSIST
FGGSPITMAAGLANLSYLLEHDLQGNARRVGGLLIERVRAAAAGVAEVREVRGRGLMIGI
ELTEPGTDRANPDAAGAVLEAARENGLLIGKGGAHNTSTLRIAPPLSLTVSEAEEGAAIL
EQALRSL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcctgtacgcccggcacaaggccgtcatccccgactgggtcgccctctactac
cgcgaccccctggagatcacccacggcgagggccgccacgtctgggacgccgagggccgc
aagtacctcgacttcttcggcggcatcctcaccaccatgaccgcccacgccctgcccgag
gtcaccaaggccgtctccgagcaggccgggcggatcatccactcctcgacgctctacctc
aaccgccccatggtggagctcgccgagcgcgtcgccggcctctccggcatccccgacgcc
cgggtcttcttcaccacctccggcaccgaggccaacgacacggccctcctcctcgccacc
gcgtaccgccgctccaaccagatcctggcgatgcgcaacagctaccacggccgctccttc
tccaccgtcggcatcaccggcaaccgcacctggtcgaccaccggcctctccccgctgcag
acgctgtacgtgcacggcggcgtccgcggccgcggcccgtacgccgggctcaccgacgag
cggttcatcgaggcctgcgtcgccgacctggaggacgtgctcggccagacccgcgcgggc
gtcgccgccctcatcgccgaaccgatccagggcgtcggcggcttcacctccccgcccgac
ggcctctacgccgccttccgccgcgtcctcgaccggcacggcatcctctggatctccgac
gaggtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcccacggc
caggccggaccgcccgacatcctcaccttcgccaagggcatcggcaacggcatgtccgtc
ggcggggtcgtcgcccgcgccgagatcatgaactgcctcgacgccagctcgatctccacc
ttcggcggttcgccgatcaccatggccgccggcctcgccaacctctcgtacctcctggag
cacgacctccagggcaacgcccgacgcgtcggcggcctcctcatcgaacgcgtccgcgcg
gcggcggccggggtcgcggaggtacgggaggtacgcggccgcggcctcatgatcggcatc
gagctcaccgaacccggcaccgaccgggcgaacccggacgcggccggcgccgtcctggag
gccgcccgcgagaacggcctgctcatcggcaagggcggcgcccacaacaccagcaccctg
cgcatcgccccaccgctctcgctcaccgtctccgaggccgaggagggcgcagcgatcctc
gaacaggccctcaggtcgctctag

DBGET integrated database retrieval system