KEGG   Streptomyces vietnamensis: SVTN_32250Help
Entry
SVTN_32250        CDS       T03586                                 

Definition
(GenBank) hypothetical protein
Organism
svt  Streptomyces vietnamensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7201176..7202957
Genome map
AA seq 593 aa AA seqDB search
MAFELTGYRNLGDAFAASVAQHPDKTAVTIYRGSAEAAHESLSYAELARRAGLRAADLAQ
HLAPGERVLIALPTGTEFVELYLACLLSGLVAVPAPPVTGSSSAAQRVAAIAADCTPGLV
FADAGDLDTLAERFHAQGLGRVPVRAAAPVPAGEASPAALRGRHTDHDSLAVLQYSSGST
GTPKGVMLAHGNVLANLEAQYSVVGLNGDDSFGSWMPLHHDFGLFVQLSGALFCGATSVL
MPPTVFARRPVEWFRMMSELRTTATSAPNFAYGIALRLIKDEHLEGLDLSPLRFLINGSE
PIHAPTIAAFTKRFAQIGLRPEAVAAGYGMAEVTVYASGTPMQLPPTVLVVDAQRLADAD
HPALVPARDGRSKEITGVGRPEAFDALVVDPATLRPLSAGEVGEIWLRGDSVGRGYWGKP
DLTARAFHARPAGADDAEPGWLRTGDLGALVDGELFITGRLKEVMIVHGRNFYPHDLEHE
ARAAHPALERFVGAAFGVQAPDERIVLVHEVSPTVSAEELRAAAAAVIRRLTAATGAPVR
NVLLVRRGSVDRTTSGKIQRAAMRDRFLAGEITALHAELEPAVRRLTAGPETS
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgagctgaccggctaccggaacctcggcgacgcgttcgccgcgagcgtcgcc
caacaccccgacaagaccgcggtcaccatctaccgcggctccgccgaggccgcgcacgaa
agcctcagctacgccgaactcgcccgccgagccggcctgcgcgccgccgacctggcgcag
cacctggcccctggcgagcgcgtcctcatcgcgctgcccaccggcaccgagttcgtcgag
ctctacctcgcctgcctgctgtccggtctcgtcgccgtgcccgccccgccggtgaccggc
tccagcagcgccgcccagcgcgtcgccgcgatcgccgcggactgcaccccgggactggtg
ttcgccgacgccggggacctcgacacgctcgccgagcgcttccacgcgcagggcctgggt
cgcgtccccgtccgggccgccgcccccgtgccggccggtgaggcatctccagcggcgctc
cgcggccgccacaccgaccacgactcgctcgccgtcctccagtacagctccggctccacc
ggcaccccgaagggcgtgatgctcgctcacgggaacgtcctggcgaacctcgaggcccag
tactccgtcgtgggcctgaacggtgacgactcgttcggcagctggatgccgctgcaccac
gacttcggtctcttcgttcagctcagcggcgcactcttctgcggcgccacatcggtcctg
atgccgccgacggtgttcgcccgcaggcccgtcgagtggttccggatgatgagcgaactc
cggaccaccgccacctccgcccccaacttcgcgtacggcatcgcgctgcgcctcatcaag
gacgaacacctcgaagggctcgacctgtcaccgctgcgcttcctgatcaacggttccgag
ccgatccatgcccccaccatcgccgcgttcaccaagcgattcgcgcagatcggcctgcgt
cccgaagccgtcgcggccggctacggcatggccgaggtcaccgtctacgccagcggcacc
cccatgcagctcccgccgaccgtcctggtcgtcgacgcccagcgcctcgctgacgcggac
caccccgcgctggttcccgcccgtgacggccgcagcaaggagatcaccggcgtcggacgc
cccgaggccttcgacgccctcgtcgtcgaccccgccaccctgcgccccctgtccgccggc
gaggtcggcgagatctggctgcgcggcgacagcgtcggccgcggctactggggcaagccc
gacctcaccgcccgtgccttccacgcccgccccgccggtgctgacgacgccgaacccggc
tggctgcgcaccggcgacctgggtgccctggtggacggcgaactgttcatcaccggtcgg
ctcaaggaggtgatgatcgtccacggccgcaacttctacccgcacgacctcgaacacgag
gcgcgcgccgcccaccccgcgctggagaggttcgtcggcgccgccttcggcgtccaggca
cccgacgagcggatcgtgctggtgcacgaggtcagcccgaccgtatcggccgaggaactg
cgcgccgccgcggcagccgtcatccgccgcctcaccgccgccaccggtgcgccggtccgc
aacgtcctgctggtgcggcgcggcagcgtcgaccgcaccaccagtggcaagatccagcgc
gccgcgatgcgcgaccgcttcctggccggcgagatcactgccctgcacgccgaactcgaa
ccggcggtacggcggttgaccgcagggcccgaaacctcgtga

DBGET integrated database retrieval system