KEGG   Streptomyces violaceoruber: B1H20_29815Help
Entry
B1H20_29815       CDS       T05124                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
svu  Streptomyces violaceoruber
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:svu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B1H20_29815
   00650 Butanoate metabolism
    B1H20_29815
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1H20_29815
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1H20_29815
Enzymes [BR:svu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B1H20_29815
Amino acid related enzymes [BR:svu01007]
 Aminotransferase (transaminase)
  Class III
   B1H20_29815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6839578..6840861
Genome map
AA seq 427 aa AA seqDB search
MSGLYERHRAVSPEWLALYYRHPVELTHGDGRYVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVAEQAGRIIHSSTLYLNRPMVELAERIAALSGIPDARVFFTTSGTEANDTALLLAT
AYRGSNQILAMRNSYHGRSFSTVSITGNQAWSPTSLSPLQTLYVHGGVRSRGPYAELSDE
RFIEACVADLEDLLGHTRVPAALIAEPVQGVGGFTSPPDGLFAAFRQVLDRHGVLWISDE
VQTGWGRTGDHFWGWQAHAEHGPPDILTFAKGIGNGMSVGGVVARAEVMNCLDANSISTF
GGSPVTMAASLANLSYLLEHDLQGNARRVGGLLIERLRSVAAASPAVREVRGRGLMIGIE
LVRPGTDEAAPEAAAAVLEAARAGGLLIGKGGGHHTSVLRIAPPLTLTVAEAEEGAAILA
DALHAAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggactgtacgagcgccaccgcgccgtcagccccgagtggctggccctctactac
cgccaccccgtcgaactcacccacggcgacggccggtacgtctgggacgcggacggcaac
cgctacctcgacttcttcggcggcatcctcaccaccatgaccgcccacgccctgcccgag
gtcaccaaggccgtcgccgaacaggccgggcgcatcatccactcctccacgctctacctc
aaccgccccatggtggagctggccgaacggatcgccgccctctccggcatccccgacgcc
cgggtcttcttcaccacctccggaaccgaggccaacgacacggccctgctgctcgccacc
gcgtaccgcgggtccaaccagatcctcgcgatgcgcaacagctaccacggccgctccttc
tccacggtctccatcaccggcaaccaggcctggtcgcccacgagtctgtccccgctccag
accctgtacgttcacggcggcgtccgatcccggggcccctacgccgagttgagcgacgag
cggttcatcgaggcgtgcgtggcggacctggaggacctcctcggacacacccgcgtcccg
gccgctctgatcgccgaaccggtgcagggggtcggcgggttcacctctccgcccgacggg
ctgttcgccgcgttccggcaggtcctggaccggcacggggtgctgtggatctcggacgag
gtgcagaccggctggggccgtaccggcgaccacttctggggctggcaggcacacgcggag
cacggcccgccggacatcctcaccttcgccaagggcatcggcaacggcatgtcggtcggg
ggagtggtggcccgcgccgaggtgatgaactgcctcgacgccaactccatctccaccttc
ggcggttcacccgtcaccatggccgcgtcgctcgccaacctctcgtacctcctggaacac
gacctccagggcaacgcgcgacgcgtcggcgggctcctcatcgaacggctgcgctccgtc
gccgccgcgtcccccgccgtacgcgaggtgcgcggccggggactgatgatcggcatcgaa
ctggtgcggcccggcaccgacgaggccgcccccgaggccgcggcggccgtcctcgaagcg
gcccgcgcgggcgggctgctcatcggcaagggcggcggccaccacaccagcgtcctcagg
atcgccccaccgctgaccctgaccgtcgccgaggcggaggagggcgcggcgatcctcgcg
gacgccctgcacgcggcggcctga

DBGET integrated database retrieval system