KEGG   Streptomyces violaceoruber: B1H20_31315Help
Entry
B1H20_31315       CDS       T05124                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
svu  Streptomyces violaceoruber
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ARF65407
UniProt: A0A1V0UJX3
LinkDB All DBs
Position
complement(7184980..7186041)
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPLKPMLAKSVARIPPGMAYEAKWDGFRTIVYRDGDEVELGSRTGKSLTRYFPD
LVDVVRENLPPRCVIDGEIVVAHEGRLDFERLGERIHPADSRVRMLAERTPASLIAFDVL
AVDETSLLSTRQADRREVLKAALAGASAPVFLAPSTTDVDVAREWFDRYEGAGLDGIVAK
PLDLPYRPDTRAMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDSEGVLQHVGVCAA
FPMRRRAELAAELAPLRCAFADHPWGAWAQAEAHEQSRLPGTQNRWSGKKDQSWVPLRPE
RVCEVAYDHMEGDRFRHTTQFRRWRPDRSPASCVYAQLEEVVSYDLAEVLAGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcccctgaagccgatgctcgccaagtcggtggcgaggatc
ccgccgggcatggcgtacgaggcgaagtgggacggcttccgaacgatcgtctaccgggac
ggcgacgaggtcgagctcggcagtcgtacgggcaagtcgctgacccgctacttccccgac
ctggtcgacgtcgtgcgggagaaccttccgccgcgctgcgtgatcgacggggagatcgtc
gtcgcccacgagggccggctggacttcgagcggctcggcgagcgcatccatccggcggac
tcccgggtgcggatgctggccgagcgcactccggcgagcctgatcgcgttcgacgtcctg
gcggtggacgagacctcgttgctctccacccggcaggcggaccggcgggaggtgctgaag
gccgcgctcgccggggcctcggcccccgtgttcctcgccccgtccaccacggacgtcgac
gtcgcccgggagtggttcgaccggtacgagggggccgggctcgacgggatcgtggccaag
ccgctggacctgccctaccggcccgacacccgggcgatgtacaagatcaagcacgagcgg
accgccgacgtggtggtcgcgggctaccgcgagcacaagagcgggcccgtcgtcggctcg
ctgctcctcggcctgtacgactccgagggcgtgctccagcacgtcggggtctgcgcggcc
ttcccgatgaggcggcgcgccgagctggcggcggaactggccccgctgcgctgcgcgttc
gccgaccatccgtggggcgcctgggcgcaggcggaggcgcacgagcagtcccggctgccg
gggacgcagaaccgctggtcgggcaagaaggaccagtcgtgggtgccgctgcgcccggag
cgggtgtgcgaggtggcgtacgaccacatggagggcgaccggttccggcacaccacccag
ttccgccggtggcggccggaccggtcccccgcgagctgtgtgtacgcgcagttggaggag
gtcgtctcctacgatctcgccgaggtgctggcgggcggctga

DBGET integrated database retrieval system