KEGG   Staphylococcus warneri: A284_03855Help
Entry
A284_03855        CDS       T02449                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
swa  Staphylococcus warneri
Pathway
swa00010  Glycolysis / Gluconeogenesis
swa00071  Fatty acid degradation
swa00280  Valine, leucine and isoleucine degradation
swa00310  Lysine degradation
swa00330  Arginine and proline metabolism
swa00340  Histidine metabolism
swa00380  Tryptophan metabolism
swa00410  beta-Alanine metabolism
swa00561  Glycerolipid metabolism
swa00620  Pyruvate metabolism
swa00625  Chloroalkane and chloroalkene degradation
swa01100  Metabolic pathways
swa01110  Biosynthesis of secondary metabolites
swa01120  Microbial metabolism in diverse environments
swa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A284_03855
   00053 Ascorbate and aldarate metabolism
    A284_03855
   00620 Pyruvate metabolism
    A284_03855
  Lipid metabolism
   00071 Fatty acid degradation
    A284_03855
   00561 Glycerolipid metabolism
    A284_03855
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A284_03855
   00310 Lysine degradation
    A284_03855
   00330 Arginine and proline metabolism
    A284_03855
   00340 Histidine metabolism
    A284_03855
   00380 Tryptophan metabolism
    A284_03855
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A284_03855
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A284_03855
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A284_03855
Enzymes [BR:swa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A284_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SIMPL VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AGC90092
UniProt: L7WQK3
LinkDB All DBs
Position
808760..810187
Genome map
AA seq 475 aa AA seqDB search
MRHFTKQYINGEWVDSASGETIEVINPATEEVIGSVAKGNEEDVNKAVEAADNVYLYFRH
SSVEYRRDLLDKIVKEYENRKEDIVQAITDELGAPLSISEKVHYQMGLNHFTAARDALDS
FEFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSTVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIEEAAKATTGKVVNNTGQVCTAGTRVLVPNSIKEDFLKAVK
AQFSSVKVGDPREEGTQVGPIISKKQFDQVQSYIDKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNHMTIAQEEIFGPVMSVITYNDVDEAIKIANDTKYGLAGYVIGNDKDTLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagacatttcactaaacaatatattaatggtgaatgggttgatagtgctagtggtgaa
acaatagaagtaattaaccctgcaactgaagaagtcattggttcagtggctaaaggtaac
gaagaagatgtgaataaagcagttgaagctgcagataatgtttatttatatttccgtcat
agttcggttgaatatagaagagatttattagataaaatcgttaaggaatatgaaaataga
aaagaagatatcgtacaagcaatcactgatgaacttggtgcgccattatcaatttctgaa
aaagtccattatcaaatgggacttaatcatttcactgcagctagagatgctttagacagt
tttgaatttgaagaacaacgtggtgacgatttagttgttaaagaagctatcggtgtagca
ggattagttacaccatggaatttcccaactaaccaaacatcacttaaattagctgcagca
tttgcggcagggagtactgttgtattaaaaccatcagaagaaacaccatttgctgctgtt
atattagctgaaatctttgataaagtaggcgtgcctaaaggtgtatttaaccttgtaaat
ggtgacggtgaaggtgtaggtaatccgttaagtgaacatcctaaagttagaatgatgtca
tttacaggttcaggccctacaggttcaaaaattatggaaaaagcagctaaagacttcaaa
aaagtgtcactagaacttggtggtaaatcaccttatatcgttttagatgatgttgatatt
gaagaggcagctaaagcaacaacaggtaaagttgtcaataatactggacaagtatgtact
gcaggtacacgtgtattagtaccaaatagtattaaagaagacttcttaaaagctgtgaaa
gcacaatttagttctgttaaagtcggtgatcctagagaagaaggtacacaagttggaccg
attattagtaagaaacaatttgaccaagttcaatcatatattgataaaggtattgaagaa
ggtgcagaattattttacggaggtcctggtaaacctgaaggtctagaaaaaggatatttt
gctcgtcctactattttcattaacgttgataatcatatgactattgctcaagaagaaatt
tttggtcctgttatgtcagtgatcacttataatgatgtagacgaagcaattaaaatagca
aatgatacgaaatatggtctagctggttatgtcattggtaatgataaagacacattacac
aaagtggcacgttcaattgaagctggaacagttgaaattaatgaagctggacgtaaacca
gatttaccatttggtggttataaacaatctggattaggtcgtgaatggggcgactacgga
attgaagaattcttagaagtaaaatcaattgcaggttattttaaataa

DBGET integrated database retrieval system