KEGG   Sphingomonas wittichii: Swit_4139Help
Entry
Swit_4139         CDS       T00538                                 

Definition
(GenBank) alanine racemase domain protein
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
swi  Sphingomonas wittichii
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Swit_4139
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Swit_4139
Enzymes [BR:swi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Swit_4139
Peptidoglycan biosynthesis and degradation proteins [BR:swi01011]
 Precursor biosynthesis
  Racemase
   Swit_4139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4546531..4547685
Genome map
AA seq 384 aa AA seqDB search
MNCLEVHRDIGVHEVADRRGNAFQLDERAFHANVEQVRRLLPPGTKIYQCAKGDGYGVGV
ERIVCLGVRAGVDGFCLGTPEEALRAKCVAAGRPVLLFAGCDPAALGEMVEAGIIVSISS
VEGCEALLRSGATGDVFFKLDCGFRRYGLNEPDLRTVLARVRRQSSVRCIGAYSHFGSRA
DEIVDGGLPLFDRLTRLIEDAVQRPIETMVASSTLILQRPGLGHSAVDPGRLLYGMMAAG
PEMPPFQPIVPRISSRLLQVTPFDEARLLTVGYADKTAIPAGGATGVFPLGWIDGLSAHR
GFGEVLIRGTRLSVVARTLQHSIVNLSGLSDVRVGDEVVLVGAQGDEQIGLEAMASAQGM
SVTEAHFRLLAAIAAGVPNGRQHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcctggaagttcatcgggatatcggggtgcatgaggtcgccgatcgtcgcggc
aacgcgttccagctcgatgagcgggccttccatgccaatgtcgagcaggtgcgcaggctg
ctgccgcctgggacgaagatctatcagtgcgccaagggcgatggttatggtgtgggtgtc
gagcggatcgtttgcctgggcgtgcgggccggtgtcgacggcttctgtctgggaacgccc
gaggaggcgctgcgggcgaagtgcgttgctgcgggtcgtccggtgctcctgttcgcgggc
tgtgatcctgcggcgctgggcgagatggtcgaggccggcatcatcgtctcaatcagcagc
gtcgaaggctgcgaggcattgttgcgctccggcgcgacgggcgacgtcttcttcaagctc
gattgcgggtttcggcgctatggactgaacgagccggacctgcggaccgttctggctagg
gttcggcgccagtcatcggtccgctgcatcggtgcctattcgcatttcggcagccgcgcc
gatgagatcgtcgatggcggtctgccgctgttcgatcggctgactcgactgatcgaggat
gccgtgcagcgaccgatcgagacgatggtcgcgagcagcacgctgatattgcagcggccg
ggcctcggtcattcggcggtggatcccggacggcttctctatgggatgatggcggcgggt
ccggagatgccgcccttccagcccatcgtgccgcgaatctcgagcaggctgcttcaggtc
acgcctttcgacgaggcgcgtctgctgacagtcggctatgccgacaagaccgccatcccc
gccggtggagcgacgggcgtgttcccgctgggttggatcgacggactgtccgcgcatcgc
ggtttcggtgaggtcctcatacgcggaactcgcctttccgtggttgcccgcaccctccag
cattcgatcgtgaatctgtcggggctgtccgatgtgcgggtcggtgacgaggtcgttctg
gtcggcgcgcagggcgacgagcagatcggcttggaggccatggcgagcgcgcagggcatg
agcgtcaccgaagcccatttccgactgctcgccgcgattgcggcgggtgtgccgaacggc
cgtcagcacggctga

DBGET integrated database retrieval system