KEGG   Sphingobium yanoikuyae: A6768_03505Help
Entry
A6768_03505       CDS       T05170                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sya  Sphingobium yanoikuyae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sya00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A6768_03505
  Lipid metabolism
   00600 Sphingolipid metabolism
    A6768_03505
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A6768_03505
Enzymes [BR:sya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A6768_03505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
748143..750824
Genome map
AA seq 893 aa AA seqDB search
MKTLRTILLASCLLSPATLLAAPRDSVSISRDWRFTKDDPAGLTEDLRYDVRPRIEDAGD
GKVADARPDAAVQVDDSGARVLKPWILPSANPFIADPARHHIRPAGNPGGTVSYVQPGFD
DSGWTHVDLPHDWAIAGPFIKDGPYGGMGRLPSWGIGWYRKALTIPASDKGKSIFLDVEG
AMSYATVWLNGRLVGGWPYGYNSFRLDLTPYAVPGGQNQLVIRLDNPQASARWYPGGGLY
RDIYLTTTNKVHVGQWGSIVRTPQVSKAQASVDLSLTLDNDGDTPAQVEVATALYAIDAT
GKRIGRPVASIARQSTSIAPHGKAELKGSTILSNPRLWGPPPTQAPNRYVAVSTVTQSGK
LIDSYETRFGVRDIKFDPDKGVIVNGEQIPLRGVNNHHDLGALGAAFNARAAERQLEILR
DMGTNAVRMSHNPPAPELLELTDRMGFLVMDEVFDSWEKKKTPHDFHLIFPDWHEADARA
MLRRDRNHPSIIIWSIGNEVGEQYDGEAGAKIGRELVAIAHQEDPTRPATSAMNYAKADM
ALPSTVDVISLNYQGAGIRGIVGQYPAFRAKFPDKVILSTESASALSSRGEYMFPVAGAI
SGPVRPWSGGNPDTHQVSAYEMHAADFGSSPDRVWAADDQNPYVAGEFVWTGFDYLGEPT
PYYTSRSSYSGILDLAGFPKDRFWLYQARWRPDLKFAHILPHWTWPDRVGQITPVHVFSS
ADEAELFVNGKSQGKVKKRDYEYRFRWDYVVYEPGEVKVVTWKKGQPWATETIRTVGEAA
KLSLTADRSAIADDGRDLSFVTLKVLDKDGNVVPAAKQDISFSIEGPGEIIATDNGDPTD
LNAFPSKERKAFNGLALVIVKAKPGEKGRVTVRASAPGLTAAQAVISTNATVR
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctgcgcaccatcctgctcgcctcctgcctgctcagccccgccacgctgctg
gccgcgccgcgcgacagcgtctcgatcagccgcgactggcgcttcaccaaggacgatcct
gccggcctgaccgaggatctgcgctatgatgtacgccctcgaatagaggatgccggcgac
ggcaaggtggccgatgcccgccccgacgcggcggtgcaggtggacgacagcggcgcgcgg
gtgctcaagccctggatattgcccagcgccaatccctttatcgccgatcccgccaggcat
cacatccgccccgccggcaatcctggcggcaccgtctcctatgtccagcccggcttcgac
gacagcggctggacccatgtcgacctgccgcatgactgggcgatcgccggccccttcatc
aaggatggcccctatggcggcatgggccgcctgcccagctggggcattggctggtatcgc
aaggcactgaccatccccgccagtgacaagggcaagtcgatcttcctcgatgtcgaaggg
gcgatgtcctacgcgaccgtctggctgaatggtcggctcgtcggcggctggccctatggc
tataacagcttccgcctcgacctcaccccctatgcggtgccgggcgggcagaaccagctg
gtgatccgcctcgacaatccccaggcctcggcccgctggtatccgggcggcggcctctat
cgcgacatctatctcaccaccaccaacaaggtccatgtcggccagtggggcagcatcgtc
cgcacgccgcaggtcagcaaggcgcaggccagcgtggacctcagcctcaccctcgacaat
gacggcgacaccccggcgcaggtcgaggtcgcgaccgccctctatgcgatcgacgcgact
ggcaagcgcatcggccgccccgtcgccagcatcgcccgccagtccaccagcatcgccccc
catggcaaggcggagctgaagggcagcacgatcctcagcaacccgcgcctctggggcccg
ccgcccacgcaagcgcccaatcgctatgtcgccgtctccaccgtgacccaaagcggcaag
ctgatcgacagctacgagacccgcttcggcgtgcgcgacatcaaattcgatcccgacaag
ggtgtgatcgtcaatggcgagcagatcccgctgcgcggcgtcaacaatcatcatgacctt
ggcgcactcggtgccgccttcaacgcccgcgcggccgagcgtcagctcgaaatattgcgc
gacatgggcaccaacgccgtgcgcatgagccataatccgcccgcgcccgaactgctcgaa
ctcaccgaccgcatgggcttcctggtgatggacgaggtgttcgacagctgggagaagaag
aagaccccgcacgatttccacctgatcttccccgactggcatgaggccgacgcgcgcgcc
atgctgcgccgtgaccgcaaccatccctcgatcatcatctggagcatcggcaacgaggtc
ggcgaacaatatgatggcgaggcgggggcgaaaatcggccgcgaactggtcgccatcgcc
catcaggaagacccgacccggcccgccaccagcgcgatgaactatgccaaggcggacatg
gctctgcccagcacggtggacgtcatcagcctcaattatcagggcgccggcattcgcggc
atcgtcggccaatatcccgccttccgcgcgaaattcccggacaaggtcatcctgtccacc
gaaagcgcatcggccctgtccagtcgcggcgaatatatgttcccggtggccggcgcgatc
agcggtccggtgcgcccctggtcgggcggcaatcccgacacgcatcaggtctccgcctat
gagatgcacgccgccgatttcggctcctcgcccgatcgggtctgggccgccgatgaccag
aatccctatgtcgcgggcgagttcgtctggaccggcttcgattatctgggcgaaccgaca
ccctattacacgtcgcgcagttcctattccggcatcctcgatctcgccggcttccccaag
gaccgcttctggctctaccaggcgcgctggcggcccgacctcaaattcgcgcatatcctg
ccgcactggacctggcccgaccgggtgggtcagatcacgccggtccatgtcttctcctcg
gccgacgaggcggagctgttcgtcaacggcaagtcgcagggcaaggtcaagaagcgcgat
tatgaatatcgcttccgctgggattatgtcgtctacgaaccgggcgaggtgaaggtcgtc
acctggaagaagggccagccctgggcgaccgagacgatccgcaccgtgggcgaggcggcg
aaactgtcgctgaccgccgatcgcagcgccattgccgatgacggccgcgacctcagtttc
gtcacgctcaaggtcctcgacaaggatggcaatgtcgttcccgccgccaagcaggacata
agcttctcgatcgagggaccgggcgagatcatcgccaccgacaatggcgacccgaccgac
ctgaacgcctttccgtcgaaggagcgcaaggctttcaacggcttggcgctcgtgatcgtc
aaggccaagccgggcgagaaggggcgggtgaccgtccgcgccagcgcgccgggcctgacc
gcggcgcaggccgtcatcagcacaaatgccacagtccgctga

DBGET integrated database retrieval system