KEGG   Sphingobium sp. YBL2: TZ53_05665Help
Entry
TZ53_05665        CDS       T03855                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
syb  Sphingobium sp. YBL2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1199306..1200781
Genome map
AA seq 491 aa AA seqDB search
MTDTLLHLANPEKLFIGGDWSPSSGSDGIEIISPATEEKVGRVAKATTADMDRAIAAARN
AFDNGPWPRMTGPERAVYLRRIAEEMARRNDDFARAWSLQVGMPYSQSSMTAPFMGGYYT
YAADLAEKGFEEVRPALAGGHAIVVREPVGVVAAVVPWNAPLATLSLKVAFALAAGCTII
AKPSPETPLEALILAECIAAAGVPDGVFSVLTADREVSDYLIRHEGVDKVSFTGSTAAGL
HIASVVSARSGRITTELGGKSAAIILDDADIGKVVEGIMPNLVGLCGQQCAAFSRILVPA
SLKGAVEEALAAAMQYVQVGDPFTETTQMGPLVTQRQHGRVFDYIQQGKAQGARIVTGGN
RPAHLDKGWFVEPTLFTDASNNMTIAREEIFGPVGTIIAYGSEEEAIAIANDNIYGLSGG
VFTQDVERAYKVARRIRTGNFGHNGRVIDYTIPYGGFKQSGVGREGGEEGLHGFTEIKAV
FMQDLPAHLKG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgcttctccacctcgcgaaccccgaaaagctgttcatcggcggcgactgg
tccccttcttcgggatcggacggtatcgagatcatctcgcccgccaccgaggagaaagtg
ggccgcgtcgccaaggcgaccaccgccgacatggaccgcgccatcgcggcggcgcgcaat
gccttcgacaacggcccctggccccgcatgaccgggccggagcgcgccgtctatctgcgc
cgcatcgctgaggaaatggccaggcgcaacgacgatttcgcccgcgcctggtcgctgcag
gtgggcatgccctattcgcaatcgtcgatgacggcccccttcatgggcggctattacacc
tatgccgcggaccttgccgaaaaggggtttgaggaggtgcgccccgccctggccggcggg
catgccatcgtcgtgcgcgagccggtgggcgtcgtcgccgccgtggtgccgtggaacgcg
ccgctggccacgctctccttgaaggtcgccttcgcgctggcggcaggctgcacgatcatc
gccaagccttcgcccgaaacgcctctggaagcgctgatcctggccgaatgcatcgcggcg
gcgggcgtgcccgacggcgtcttttccgtcctgacggcggatcgcgaagtgtccgattat
ctgatccgccatgaaggggtggacaaggtcagcttcaccggttcgaccgccgccggcctg
cacatcgcctcggtcgtcagcgcccggtcgggacgcatcacgacggaactgggcggcaag
tccgccgccatcatcctggacgatgccgacatcggcaaggtcgtggaagggatcatgccg
aacctggtcgggctgtgcggccagcaatgcgccgccttcagccgcatattagtgcccgcc
tcattgaagggcgcggtggaggaagcgctcgccgccgccatgcaatatgtgcaggtgggc
gatcctttcactgaaacgacgcagatgggcccgctcgtcacccagcgccagcatggccgc
gtcttcgactatatccagcaggggaaggcgcagggcgcccgcatcgtcactggcggcaac
cgcccggctcatctcgacaagggctggttcgtggagccgaccctgttcaccgacgccagc
aacaacatgaccatcgcccgcgaggagattttcggacccgtcggcacgatcatcgcctat
ggcagcgaggaagaggcgatcgccatcgccaacgacaatatctacggcctgtcgggcggg
gtgttcacgcaggatgtcgagcgcgcctacaaggtcgcccgccgcatccgtaccggcaat
ttcggccataatggccgcgtcatcgactacaccattccctatggcggcttcaaacagtcc
ggcgtgggccgcgagggcggtgaggaagggttgcacggcttcaccgagatcaaggccgtc
ttcatgcaggatctgcctgcccatctgaagggctga

DBGET integrated database retrieval system