KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2252Help
Entry
Synpcc7942_2252   CDS       T00300                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00620  Pyruvate metabolism
syf00680  Methane metabolism
syf00710  Carbon fixation in photosynthetic organisms
syf01100  Metabolic pathways
syf01120  Microbial metabolism in diverse environments
syf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Synpcc7942_2252
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Synpcc7942_2252
   00680 Methane metabolism
    Synpcc7942_2252
Enzymes [BR:syf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Synpcc7942_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABB58282
JGI: Syn_pcc79422252
CyanoBase: Synpcc7942_2252
CYORF: Synpcc7942_2252
UniProt: Q31KY7
LinkDB All DBs
Position
complement(2318927..2321980)
Genome map
AA seq 1017 aa AA seqDB search
MNYCQNARTAMSAALQSSDDAFRTVSSPLATDLDLSSPLEFFLRHRLTVVEELWEVVLRQ
ECGQELVDILTQLRDLTSPEGQAPEVGGEALVQVIETLELSDAIRAARAFALYFQLINIV
EQHYEQTQYQLAYERSRLEPLPGPDESPEGLHTIEIPQHQLDPFAAVIPLNQDPATFQTL
FPRLRQLNVPPQMIQELTDRLDIRLVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGK
NRGFRELEAQNIRQQLTEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQ
RFRLALQGTFPDLQPPRYNFCQFGSWVGSDRDGNPSVTSAVTWQTACYQRSLVLDRYITA
VEHLRNVLSLSMHWSEVLPELLSSLEQESMLFPETYEQLAVRYRQEPYRLKLSYILERLH
NTRDRNTRLQQQQEKDPTTPLPEYRDGTLYQAGTAFLEDLKLIQHNLKQTGLSCYELEKL
ICQVEIFGFNLVHLDIRQESSRHSDAINEICEYLQILPQPYNELSEAERTAWLVQELKTR
RPLVPARMPFSESTREIIETLRMVKQLQEEFGEAACQTYIISMSRELSDLLEVLLLAKEV
GLYDPVTGKSSLQVIPLFETVEDLQNAPRVMTALFELPFYTQLNPTQSEPLQEVMLGYSD
SNKDSGFLSSNWEIHKAQKALGTVARDHRVKLRIFHGRGGSVGRGGGPAYEAILAQPGRT
TDGRIKITEQGEVLASKYALPELALYNLETITTAVIQSSLLGSGFDDIEPWNQIMEELAA
RSRRHYRALVYEQPDLVDFFNQVTPIEEISKLQISSRPARRKTGKRDLGSLRAIPWVFSW
TQSRFLLPSWYGVGTALQEFLQERPEQNLNLLRYFYEKWPFFRMVISKVEMTLAKVDLQI
AHHYVHELANPEDQERFERVFSQIAAEFQLTCHLVLTITNHGRLLDGDPELQRSVQLRNG
TIVPLGFLQVALLKRLRQYRQQTETTGLMRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgaattactgccagaacgctcgaactgccatgagtgctgctctccagtcatccgacgat
gctttccgaaccgtttcgagtcccctcgccacggatttggatctgtcgtctccgctggag
tttttccttcgccatcgcttgacggtggttgaagaactctgggaagtggttttgcgccaa
gagtgcggccaagagctggtcgatattctgactcagctgcgtgacttgacctcgccggaa
ggccaagccccagaagtgggcggcgaagccttggttcaggtgattgaaaccctagagttg
agcgatgcgattcgggctgcccgtgcctttgcgctctactttcagctgatcaatattgtt
gagcagcactacgagcaaactcaatatcaactcgcctacgagcgatcgcggttggaaccc
ttgccaggaccagatgaaagtccggagggattgcacaccattgaaattcctcagcatcag
ctcgatccctttgctgcggtgattccgctcaaccaagatccggcaaccttccaaacgctg
ttcccgcgcctgcgccagctcaatgtgccgccgcaaatgatccaagagctgaccgatcgc
ctcgatattcggctggttttcaccgctcacccgacggaaattgtccgccacacgattcgc
gacaaacaacgccgaattgcctacctgctgcggcaactggatgagctcgaaacaggcaaa
aaccgaggctttcgagagcttgaagcgcagaatattcgtcagcagctgaccgaggagatt
cggctctggtggcggacggatgagctccaccagttcaagccaacggtgttggatgaggtg
gactacgcgctccactacttccaagaagtcctctttgaggccattcctctgctctatcag
cgctttcggctcgcgctgcaggggactttccccgacctacaaccgccccgctacaacttc
tgccagttcggctcttgggtcggctccgatcgcgatggcaatccttcagtgacctctgcc
gtcacttggcaaaccgcttgctatcagcgcagtctcgtcctcgatcgctacatcacagcg
gttgaacatctccgcaatgtgctcagcctctcgatgcactggagcgaggtgctgccggag
ttgctcagctcgttggaacaggagagcatgctcttcccggagacctatgagcagctagcg
gtccgctatcgccaagagccctatcgcctcaagctctcctatattctggagcgcctgcac
aacacccgcgatcgcaatacccgcctccaacagcagcaagaaaaagatcccaccacgccc
ctgcccgaatatcgggatggcaccctctaccaggctggtacggcctttctcgaagatctc
aagctgattcagcacaaccttaagcagacgggactgagctgttacgagctagagaagttg
atctgccaggtcgagatctttggtttcaacctggtccatctcgacattcgccaagaaagc
tcgcgccattccgacgcgatcaacgaaatctgtgaatacctccaaattcttccccagccc
tacaacgagctgagcgaagcagaacgaactgcctggctggttcaagagctgaaaacccgt
cggccgctggtaccagcgcgcatgccgttctcagaatcgacccgcgagatcattgaaacc
ctgcggatggtcaagcagctacaggaagaatttggggaggcggcttgccaaacctacatc
atcagcatgagccgcgagctgagcgacctgctggaagtgctgctgctggccaaggaggtt
ggtctctacgacccagtcaccggcaagagttcgcttcaggtgattccgctgtttgaaact
gtggaggacttacaaaatgccccgcgggtgatgacggcgctgtttgagctgcccttctac
acccagctcaaccccacccagtctgaaccgctgcaggaagtgatgctggggtattccgac
agtaacaaggactcgggcttcctcagcagtaactgggagatccacaaggcccagaaagcc
ctagggacggtagcccgcgaccaccgcgtcaagctgcggatcttccacggccgcgggggc
tccgtcggtcgaggtggtggccctgcctacgaggcgatcttggcccagccgggtcgcacc
acagatggccgaatcaagattacggaacagggcgaggtcttggcttcgaaatacgccctg
cccgaactggcgctctataaccttgagacgatcacgacggcggtgattcagtccagcctg
ctgggtagcggctttgatgacattgagccgtggaaccaaattatggaagagttggcggcg
cgatcgcggcgacattaccgcgctttggtgtacgagcagcccgacctggttgacttcttc
aatcaggtaacgccgattgaggagatcagcaaactgcaaatcagctcgcgaccggctcga
cgcaaaaccggcaagcgcgatctgggcagtctacgtgccatcccctgggtctttagctgg
acgcagagtcgttttctgctgccctcttggtatggcgtcggcacagcacttcaggagttt
ttgcaggagcgcccggagcagaacctcaacctgctgcgctacttctacgagaagtggccg
ttcttccgcatggtgatctcgaaggtcgagatgaccctagcgaaggtcgatttgcagatt
gctcatcactacgtgcatgagctggccaatcctgaggatcaagagcggtttgaacgagtg
ttcagccaaatcgctgcagagtttcagctgacttgtcatctcgtgttgacgattaccaac
cacggtcgcttgctggatggcgaccccgaactgcagcgatcggtgcagctgcgcaacggt
acgatcgtgcccctcggcttcttgcaagtcgccctgcttaaacgcctgcggcagtatcgc
cagcaaacggaaacgacgggattgatgcgatcgcgctatagcaaaggggaactgctgcgc
ggagcattgctgacgatcaacggcattgcggctggcatgcgcaatacaggttga

DBGET integrated database retrieval system