KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2252Help
Entry
Synpcc7942_2252   CDS       T00300                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Synpcc7942_2252
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Synpcc7942_2252
   00680 Methane metabolism
    Synpcc7942_2252
Enzymes [BR:syf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Synpcc7942_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(2318927..2321980)
Genome map
AA seq 1017 aa AA seqDB search
MNYCQNARTAMSAALQSSDDAFRTVSSPLATDLDLSSPLEFFLRHRLTVVEELWEVVLRQ
ECGQELVDILTQLRDLTSPEGQAPEVGGEALVQVIETLELSDAIRAARAFALYFQLINIV
EQHYEQTQYQLAYERSRLEPLPGPDESPEGLHTIEIPQHQLDPFAAVIPLNQDPATFQTL
FPRLRQLNVPPQMIQELTDRLDIRLVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGK
NRGFRELEAQNIRQQLTEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQ
RFRLALQGTFPDLQPPRYNFCQFGSWVGSDRDGNPSVTSAVTWQTACYQRSLVLDRYITA
VEHLRNVLSLSMHWSEVLPELLSSLEQESMLFPETYEQLAVRYRQEPYRLKLSYILERLH
NTRDRNTRLQQQQEKDPTTPLPEYRDGTLYQAGTAFLEDLKLIQHNLKQTGLSCYELEKL
ICQVEIFGFNLVHLDIRQESSRHSDAINEICEYLQILPQPYNELSEAERTAWLVQELKTR
RPLVPARMPFSESTREIIETLRMVKQLQEEFGEAACQTYIISMSRELSDLLEVLLLAKEV
GLYDPVTGKSSLQVIPLFETVEDLQNAPRVMTALFELPFYTQLNPTQSEPLQEVMLGYSD
SNKDSGFLSSNWEIHKAQKALGTVARDHRVKLRIFHGRGGSVGRGGGPAYEAILAQPGRT
TDGRIKITEQGEVLASKYALPELALYNLETITTAVIQSSLLGSGFDDIEPWNQIMEELAA
RSRRHYRALVYEQPDLVDFFNQVTPIEEISKLQISSRPARRKTGKRDLGSLRAIPWVFSW
TQSRFLLPSWYGVGTALQEFLQERPEQNLNLLRYFYEKWPFFRMVISKVEMTLAKVDLQI
AHHYVHELANPEDQERFERVFSQIAAEFQLTCHLVLTITNHGRLLDGDPELQRSVQLRNG
TIVPLGFLQVALLKRLRQYRQQTETTGLMRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgaattactgccagaacgctcgaactgccatgagtgctgctctccagtcatccgacgat
gctttccgaaccgtttcgagtcccctcgccacggatttggatctgtcgtctccgctggag
tttttccttcgccatcgcttgacggtggttgaagaactctgggaagtggttttgcgccaa
gagtgcggccaagagctggtcgatattctgactcagctgcgtgacttgacctcgccggaa
ggccaagccccagaagtgggcggcgaagccttggttcaggtgattgaaaccctagagttg
agcgatgcgattcgggctgcccgtgcctttgcgctctactttcagctgatcaatattgtt
gagcagcactacgagcaaactcaatatcaactcgcctacgagcgatcgcggttggaaccc
ttgccaggaccagatgaaagtccggagggattgcacaccattgaaattcctcagcatcag
ctcgatccctttgctgcggtgattccgctcaaccaagatccggcaaccttccaaacgctg
ttcccgcgcctgcgccagctcaatgtgccgccgcaaatgatccaagagctgaccgatcgc
ctcgatattcggctggttttcaccgctcacccgacggaaattgtccgccacacgattcgc
gacaaacaacgccgaattgcctacctgctgcggcaactggatgagctcgaaacaggcaaa
aaccgaggctttcgagagcttgaagcgcagaatattcgtcagcagctgaccgaggagatt
cggctctggtggcggacggatgagctccaccagttcaagccaacggtgttggatgaggtg
gactacgcgctccactacttccaagaagtcctctttgaggccattcctctgctctatcag
cgctttcggctcgcgctgcaggggactttccccgacctacaaccgccccgctacaacttc
tgccagttcggctcttgggtcggctccgatcgcgatggcaatccttcagtgacctctgcc
gtcacttggcaaaccgcttgctatcagcgcagtctcgtcctcgatcgctacatcacagcg
gttgaacatctccgcaatgtgctcagcctctcgatgcactggagcgaggtgctgccggag
ttgctcagctcgttggaacaggagagcatgctcttcccggagacctatgagcagctagcg
gtccgctatcgccaagagccctatcgcctcaagctctcctatattctggagcgcctgcac
aacacccgcgatcgcaatacccgcctccaacagcagcaagaaaaagatcccaccacgccc
ctgcccgaatatcgggatggcaccctctaccaggctggtacggcctttctcgaagatctc
aagctgattcagcacaaccttaagcagacgggactgagctgttacgagctagagaagttg
atctgccaggtcgagatctttggtttcaacctggtccatctcgacattcgccaagaaagc
tcgcgccattccgacgcgatcaacgaaatctgtgaatacctccaaattcttccccagccc
tacaacgagctgagcgaagcagaacgaactgcctggctggttcaagagctgaaaacccgt
cggccgctggtaccagcgcgcatgccgttctcagaatcgacccgcgagatcattgaaacc
ctgcggatggtcaagcagctacaggaagaatttggggaggcggcttgccaaacctacatc
atcagcatgagccgcgagctgagcgacctgctggaagtgctgctgctggccaaggaggtt
ggtctctacgacccagtcaccggcaagagttcgcttcaggtgattccgctgtttgaaact
gtggaggacttacaaaatgccccgcgggtgatgacggcgctgtttgagctgcccttctac
acccagctcaaccccacccagtctgaaccgctgcaggaagtgatgctggggtattccgac
agtaacaaggactcgggcttcctcagcagtaactgggagatccacaaggcccagaaagcc
ctagggacggtagcccgcgaccaccgcgtcaagctgcggatcttccacggccgcgggggc
tccgtcggtcgaggtggtggccctgcctacgaggcgatcttggcccagccgggtcgcacc
acagatggccgaatcaagattacggaacagggcgaggtcttggcttcgaaatacgccctg
cccgaactggcgctctataaccttgagacgatcacgacggcggtgattcagtccagcctg
ctgggtagcggctttgatgacattgagccgtggaaccaaattatggaagagttggcggcg
cgatcgcggcgacattaccgcgctttggtgtacgagcagcccgacctggttgacttcttc
aatcaggtaacgccgattgaggagatcagcaaactgcaaatcagctcgcgaccggctcga
cgcaaaaccggcaagcgcgatctgggcagtctacgtgccatcccctgggtctttagctgg
acgcagagtcgttttctgctgccctcttggtatggcgtcggcacagcacttcaggagttt
ttgcaggagcgcccggagcagaacctcaacctgctgcgctacttctacgagaagtggccg
ttcttccgcatggtgatctcgaaggtcgagatgaccctagcgaaggtcgatttgcagatt
gctcatcactacgtgcatgagctggccaatcctgaggatcaagagcggtttgaacgagtg
ttcagccaaatcgctgcagagtttcagctgacttgtcatctcgtgttgacgattaccaac
cacggtcgcttgctggatggcgaccccgaactgcagcgatcggtgcagctgcgcaacggt
acgatcgtgcccctcggcttcttgcaagtcgccctgcttaaacgcctgcggcagtatcgc
cagcaaacggaaacgacgggattgatgcgatcgcgctatagcaaaggggaactgctgcgc
ggagcattgctgacgatcaacggcattgcggctggcatgcgcaatacaggttga

DBGET integrated database retrieval system