KEGG   Synechococcus sp. WH 8109: Syncc8109_1955Help
Entry
Syncc8109_1955    CDS       T03783                                 

Gene name
rbcL
Definition
(GenBank) Ribulose bisphosphate carboxylase, large chain
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syh  Synechococcus sp. WH 8109
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syncc8109_1955 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc8109_1955 (rbcL)
Enzymes [BR:syh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syncc8109_1955 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1438670..1440085)
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKDSFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGERKGHYLNVTANTPE
EMYERAEFAKELGMPIVMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggatacctactggactcctgat
tacgtccccctcgacaccgacctgctggcctgcttcaagtgcaccggccaagaaggtgtg
cccaaggaagaagttgccgctgctgtggctgctgaatcctccaccggcacctggtccact
gtgtggtctgagctcctcaccgatctcgacttctacaagggccgttgctaccgcatcgaa
gacgtccctggtgacaaggattctttctatgccttcatcgcctaccccctcgacctgttc
gaagagggttccatcaccaacgttctgacctccctggtcggcaacgtgttcggtttcaag
gctctccgccacctccgtctggaagacatccgcttcccgatggcgttcatcaagagctgc
tacggcccgccgaacggcatccaggtcgagcgcgaccggatgaacaagtacggccgtccc
ctgctgggttgcaccatcaagccgaagctcggcctgagcggtaagaactacggccgtgtt
gtctatgagtgcctgcgtggcggtctggacttcaccaaggacgacgaaaacatcaactcc
cagcccttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctgtcc
gagcaggagaccggcgagcgcaagggtcactacctcaacgtgactgcgaacactcccgaa
gagatgtatgagcgcgctgagttcgctaaggaactcggaatgccgatcgtcatgcacgac
ttcatcaccggtggcttcacagccaacaccggtctttcgaagtggtgccgcaagaacggc
atgctcttgcacattcaccgcgccatgcacgcggtgattgaccgtcatcccaagcacggc
atccacttccgcgttctcgccaagtgtctgcgtctgtccggtggtgaccagctccacacc
ggcaccgtggtcggcaagctggaaggtgatcgtcagaccaccctcggctacatcgaccag
ctgcgcgaatccttcgtgcccgaagaccgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcctggcgtgttcgccgttgcttccggcggtatccacgtgtggcacatgcct
gcactggtcgccattttcggtgacgactccgtgctgcagttcggtggtggtacccacggt
cacccctggggctccgctgcaggtgctgctgccaaccgtgtggccctcgaggcctgcgtc
aaggcacgcaatgccggtcgcgagatcgagaaagaaagccgggacatcctcatggaagcc
ggtaagcacagccctgagctggccatcgctctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgttcagaactga

DBGET integrated database retrieval system