KEGG   Sediminicola sp. YIK13: SB49_06075Help
Entry
SB49_06075        CDS       T04145                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
syi  Sediminicola sp. YIK13
Brite
Enzymes [BR:syi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SB49_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu ATG19_autophagy ApoLp-III YpjP RRM_1 Sre Trep_dent_lipo AHSA1 YtxH
Motif
Other DBs
NCBI-ProteinID: ALM07418
UniProt: A0A0S1S3U5
LinkDB All DBs
Position
1366956..1367543
Genome map
AA seq 195 aa AA seqDB search
MKKIKLMSLIAIVALTYSCKEVKKEAKEASDEMEETMQEIKEEVTEEVIKFNMEPKSDSK
VTGDVTFTQTDGMVKMVANLNGLTAGEHAIHIHEKADCSSADGKSTGGHWNPTFQDHGKW
GAAEGYHRGDIGNFTADEVGNATVEFETDEWCIGCDDMTKNIVGKAVIVHQGVDDFVSQP
SGDAGARVSCTGIIQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaaattaatgtctctgatagccattgtagcccttacttatagttgtaaa
gaggttaaaaaagaagccaaagaagcttctgacgagatggaagagacgatgcaagaaata
aaagaagaggtcacagaagaggtaattaaattcaacatggaacctaaaagtgatagcaag
gtaacgggtgatgttacctttacacaaaccgatggcatggtaaaaatggtggccaatctt
aacggtcttacagctggagaacatgccatccacatccatgaaaaggcagattgttcctcg
gccgatggaaaatctacgggaggacactggaacccaacttttcaagatcacggaaaatgg
ggtgctgccgaaggataccacagaggagatattgggaatttcacagcagatgaggtaggt
aatgccacagtggaatttgaaacggatgagtggtgtattggttgtgatgacatgacaaag
aatattgtaggtaaggctgttattgtacaccaaggggtggacgattttgtatctcaacct
tcaggtgatgcaggtgccagggtaagttgtacaggtattatccaataa

DBGET integrated database retrieval system