KEGG   Synechocystis sp. PCC 6714: D082_32910Help
Entry
D082_32910        CDS       T03386                                 

Gene name
nrtB
Definition
(GenBank) Nitrate ABC transporter, permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
syj  Synechocystis sp. PCC 6714
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syj00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    D082_32910 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    D082_32910 (nrtB)
Transporters [BR:syj02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    D082_32910 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3276083..3276913)
Genome map
AA seq 276 aa AA seqDB search
MANIAVNRRSSRTNVFRFLAYSKKLTRPLIALIIFLVIWQIICSGPNPNLPSPITVFQET
WDPLIINPFFDNGGTDKGLGLQIFASLTRVAVGFTLAAVVGIALGILVGTSKVMYDALDP
IFQVLRTIPPLAWLPIALAALRESEPSAIFVIFITAIWPIIINTTVGVQQVPQDYRNVSR
VLQLSKLEYFFNILFPASVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGFFIWDAYNSS
NTSEIILALFYVGIVGLLLDRFVSFIASLMVPEEQK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggctaacatcgcagttaatcgacgcagttcccggaccaatgtatttcgctttttagcc
tattctaaaaaacttacccgtccattaattgccctgattatttttttggtgatttggcaa
attatctgctctggccccaaccccaatttacctagtccgatcaccgttttccaagaaacc
tgggaccctctgattattaatcccttttttgataatgggggcaccgataaaggtttgggc
ttacaaatttttgccagtttaactagggtggcagtgggctttactttagccgcagtggta
ggtattgctttaggtattttagtgggcactagcaaggtaatgtacgacgccctagaccca
atttttcaagtgctgagaactattcctcccctagcttggttgcccattgctctggcggcg
ttacgggaaagtgaaccttcggcaattttcgtaatttttatcactgctatttggccaatt
attatcaatacaacggtgggggtgcagcaagttccccaggattaccgtaacgtttcccgg
gttttacagttatcaaaattagagtattttttcaacattctttttcctgcttctgtgccc
tatattttcaccgggttacgcattggcatcggcttgtcttggttagccattgtggcggcg
gaaatgcttgtggggggcgtgggcattggcttctttatctgggatgcctataacagttcc
aacaccagtgaaattattttggccctgttctatgttggtattgttggtttgctgctagat
cgttttgtcagttttattgccagcttaatggtgccggaagaacaaaaatag

DBGET integrated database retrieval system