KEGG   Synechocystis sp. PCC 6714: D082_33220Help
Entry
D082_33220        CDS       T03386                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00630  Glyoxylate and dicarboxylate metabolism
syj00710  Carbon fixation in photosynthetic organisms
syj01100  Metabolic pathways
syj01120  Microbial metabolism in diverse environments
syj01200  Carbon metabolism
Module
syj_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syj_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syj00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D082_33220 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    D082_33220 (rbcS)
Enzymes [BR:syj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     D082_33220 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AIE75850
UniProt: A0A068N159
LinkDB All DBs
Position
3304096..3304437
Genome map
AA seq 113 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacccaaagagcgccgctacgaaaccctttcttacctgccccctttaacc
gatcaacagattgctaaacaagttgagtttcttttagaccagggctttattcccggtgtg
gaatttgaagaagatccccaacccgaaacccacttctggactatgtggaaactgcctttc
ttcggtggtgccactgccaatgaagttctagccgaagtacgggaatgccgttctgagaac
cccaactgctacattcgggtaattggttttgacaatatcaaacagtgtcagactgtaagc
ttcattgtccacaaacccaaccaaaaccaaggccgttactaa

DBGET integrated database retrieval system