KEGG   Synechococcus sp. KORDI-52: KR52_00445Help
Entry
KR52_00445        CDS       T03346                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:synd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KR52_00445
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KR52_00445
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    KR52_00445
   00680 Methane metabolism
    KR52_00445
Enzymes [BR:synd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KR52_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
69009..72002
Genome map
AA seq 997 aa AA seqDB search
MPESTTPVSDHETARLSGGGSGAGQLLQHRLDLIEDLWKSVLRSECPPEQSERLLRLKQL
SDPVSLEGRDGDSTSEAIVELIKAMDLSEAISAARAFSLYFQLINILEQRIEEDSYLDSL
RPNHSADAAQRDAFDPFAPPLANQTDPATFGEVFERLRRMNVPPAQVEHLLRELDIRLVF
TAHPTEIVRHTVRHKQRRVANLLQQLQSDTPLAHQVREDCRDQLEEEIRLWWRTDELHQF
KPTVIDEVDSTLHYFQQVLFDAMPQLRRRLIAALHRHYPDVQVPQASFCTFGSWVGSDRD
GNPSVTPEITWRTACYQRQLMLELYISSVQTLRQQLSISMQWSQVAPALLESLEMDRLRF
PEIYERRAARYRLEPYRLKLCYVLEKLERTLARNNQLSEAGWQMPCEALADSQVGLSGAE
VLHYTSVDQFRSDLELVRNSLVSTDLSCEQLDTLLHQVHIFGFSLASLDIRQESTRHSDA
IDELTRSLDLPQAYGDMDETQRMAWLLQELQTRRPLIPPAANWSAPTAETLAVFRMLQRL
QEEFGPRICNSYVISMSHTASDLLEVLLLAKETGLVDPPNKRASLLVVPLFETVEDLQRA
PEVMEGLFKTPLYRALLPVVGQQKQPLQELMLGYSDSNKDSGFLSSNWEIHQAQIALQEL
ASRQDVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELA
LYNLETVTTAVVQNSLVTNQLDATPSWNQLMSRLATRSREHYRALVHDNPDLVAFFQQVT
PIEEISKLQISSRPARRKTGAKDLSSLRAIPWVFGWTQSRFLLPSWFGFGTALSEEVGSD
TEQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMNSLGHPEQREAFEAIFQVIA
KEYELTRKLVLEITGQNRLLGADQGLQLSVDLRNRTIVPLGFLQVALLKRLRDQNRQPPM
SETPGAPEDTRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagtccaccacccctgtctccgaccatgagactgcacgcctgagtggtggtgga
tccggcgcggggcagcttcttcagcaccgcttggatctgattgaggacctctggaagtcg
gtgctgcgcagtgagtgcccaccggagcagagcgaacgtttgctgcggctcaaacaactg
agtgacccagtgtccctggaggggcgggacggcgatagcaccagcgaggcgatcgttgag
ctgatcaaagctatggacctctcagaggccatttcagccgcccgcgccttctcgctctac
ttccagctcatcaacatccttgagcagcggatcgaggaagacagctacctcgacagcctc
aggcccaatcacagtgctgatgctgcccaacgggatgcctttgatccctttgctcccccg
ctcgccaaccagactgatccagccactttcggggaggttttcgagcggctgcggcgcatg
aacgtcccccccgcgcaggtggaacacctgcttcgggagctggacatccgtctggttttc
accgcgcaccccacggaaatcgtgcggcacacagtgcgccacaagcaacggcgtgtggcc
aacctgcttcagcaacttcaatccgacacgcctcttgcccaccaggtgcgtgaggactgt
cgggaccaattggaggaggaaatccgcctgtggtggagaactgatgaacttcatcagttc
aagcccaccgtgatcgacgaggtggattcgaccctgcactacttccagcaggttctattt
gatgcaatgcctcagctgcgaagaaggctgatcgcagccctgcatcgccattaccccgat
gtccaggtcccccaggcgtcgttctgcaccttcggctcctgggtgggttccgatcgggac
gggaatccctcggtcaccccagagatcacctggagaaccgcctgctatcagcgtcagctg
atgctggagctgtacatcagttctgtgcaaacgcttcgccagcaactgagcatctccatg
cagtggagtcaggtcgcacctgcactgctggagtctctggaaatggatcggctccggttc
ccggagatctacgaacgcagagctgctcgataccggctggagccctaccgactgaagctc
tgctacgtgctcgaaaaactggagcgcaccctcgctcgcaacaaccagctgtcggaggcg
ggatggcagatgccctgtgaagcactggccgattcccaggtcgggttgagcggcgctgag
gttctccactacacctcggtggaccagttccgcagtgatctggagttggtgcgtaacagc
ctggtcagcaccgatttgagctgcgaacagctcgatacgctgctgcaccaggtgcacatc
ttcgggttctcgctggccagcctggatattcgtcaggagagcacccgccacagtgacgcc
atcgatgaactcacccgcagcctggaccttccccaggcctatggggacatggatgaaacc
cagcggatggcttggctcctgcaggaactgcagacccgtcgccccctgatccctccagcc
gccaactggtcagcgccgacagccgagacgctggctgtgttccggatgctgcagcgcctg
caggaggaattcggcccgcggatctgcaattcctatgtgatttcgatgagccacacggca
tcggatctcttggaggttttgctgctggcgaaggaaacaggcctggtggatccgcccaac
aaacgggcctcgctgttggtggtgcctctgtttgaaaccgtggaggacctccaacgggcc
cctgaggtgatggaggggctgttcaagacgccgctctaccgcgcactactccctgttgtg
gggcagcagaagcagccgctgcaggagctgatgctgggctattccgacagcaacaaggat
tccggcttcctctccagcaactgggagattcatcaggctcagatcgcacttcaggaactc
gccagtcgccaggacgtggcgcttcgcctcttccatggccgcggtggatccgtcagtcga
ggtggtgggccggcctatcaagcgatcctggcccaacccagtggcacgctgcagggccgg
atcaaaatcaccgaacagggtgaagtgctggcctcgaagtacagcctgcccgagttggcg
ctctataacttggagaccgtcaccacggccgtggttcagaacagcctggtgaccaatcag
ctcgatgcgacacccagctggaaccagctgatgagtcgccttgccacccgctcacgggag
cattacagggctttggttcacgacaatcccgatctggtggcgttcttccagcaggtcaca
ccgatcgaagaaatcagcaaactgcagatctccagccgaccggctcgacgcaaaaccggc
gccaaggacctctccagcctgcgggccattccctgggtcttcggttggacccagagccga
ttcctccttccgagctggtttggtttcggcacagccctgtctgaagaggtggggagcgac
accgaacagctcgacctgctgcgccgcctgcatcaacgttggccgtttttccggatgctc
atttccaaagtggaaatgaccctctccaaggtcgatctcgacctggcccatcactacatg
aacagcctggggcaccccgagcagcgggaggcctttgaagcgatcttccaggtgatcgcc
aaggaatatgaactcacccgcaaactggtgctggaaatcacaggccagaaccgactgcta
ggggcggatcaaggtcttcagttgtccgttgacctgcgcaatcggaccatcgttcccctg
ggctttctccaggttgcgctgctgaagcgtttgcgggatcagaaccggcaaccccccatg
agtgagacaccgggcgcccccgaggacacccgcacctacagccgaagcgagctgctgcgg
ggtgccttgctcaccctcaacggcattgccgccggcatgcgcaacaccggttga

DBGET integrated database retrieval system