KEGG   Synechococcus sp. PCC 6312: Syn6312_0592Help
Entry
Syn6312_0592      CDS       T02370                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Syn6312_0592
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syn6312_0592
   00680 Methane metabolism
    Syn6312_0592
Enzymes [BR:syne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Syn6312_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(592102..595119)
Genome map
AA seq 1005 aa AA seqDB search
MTSLLNVPNQERIEETSTDQALHKRLQLVENVLAVVLAAESGQELVELLRQLGALSSSEG
QVIPGVQTECLQVIESLELNQAIRAARAFNIYFQLINIVEQHYEQEQNRQRTVIETSPMR
ALTADHLSGVSGESFPVQSGSADVRSGPSERLEHSLYEIAPQTQPQGKLSWLFPRLKALN
VPPQHIQRLIDQLDIKLVFTAHPTEIVRQTIRDKQRRVAHILEQLDQLDMVGQIVTTDAE
ELTAQLTEEIRLWWRTDELHQFKPEVLDEVEYSLHYFKEVLFDAIPQLYRRFQKALHQSF
PQLKPPRYNFCKFGSWVGSDRDGNPSVVPEVTWQTACYQRNLVLEKYVSSVERLITLLSL
SLHWCDVLPELLESLEQDQQQLPDIYQQHSVRFRQEPYRLKLAYVLKRLQNTRQRNQQIQ
ANCAPSAAADALNNGQFYGTGTDFLAELNLIQRNLAATGLACRELDDLICQVEIFGFNLA
ILDIRQESTSHSDTIAEITEYLQILPCPYSELSESERTRWLAAELATRRPLIPSELPFSE
RTKEIIETLRMVKRLQQEFGPEICTTYVISMSHEASDLLEVLLLAKEAGLYDPATGKSTL
HVVPLFETVEDLKRAPHVLTQLFELPFYKPYLNSNDCPGLQEVMLGYSDSNKDSGFLSSN
WEIYKAQQSLQKTAEKYGFQLRIFHGRGGSVGRGGGPAYAAILAQPGQTINGRIKITEQG
EVLASKYSLPDLALYNLETITTAVIQASLLRTSIDEIEPWHEIMEELATRSRQCYRNLIY
ERPEFIDFFHQVTPIEEISQLQISSRPTRRGGKKNLASLRAIPWVFSWTQSRFLLPAWYG
VGTAIKEFIDEKPAEHLSLLRYFYYKWPFFRMVISKAEMTLAKVDLEIAHHYVQELSHEQ
DRESFETLFAQIAEEYRRTSELILTITGHQRLLDGDLPLQRSVHLRNSTIVPLGVLQVSL
LKRLRQHNSTSTSGAILRSRYSRSELLRGALLTINGIAAGMRNTG
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgctattgaacgttcccaatcaagagcggatcgaggagaccagcacagatcaa
gctctgcacaagcgtctgcaattggtcgagaatgttctcgcggtggtcttggcggcagaa
tctgggcaagaactggtagaactattgcgacagttaggggcattatcctcctcggagggg
caagtcattccgggagtccagaccgaatgtttacaggtgattgaatctttagaactgaac
caggccatccgcgcagcgcgggccttcaacatctattttcagttgattaatattgttgag
cagcactacgagcaagagcaaaatcgccagcgcaccgtcattgaaacctcgccaatgcgt
gccttaactgctgatcacttgtcgggggtgagtggggagtcctttccggtgcaaagtggt
tctgcggatgtgcggagtggccccagtgagcgattagagcatagtctttatgaaattgct
ccccaaacccagccccaagggaagctttcctggttatttcctcgcctaaaagcactcaat
gtcccgccccaacatattcaacggctgattgatcaactggatattaaactggttttcacc
gcccaccccaccgaaattgtccggcaaacgattcgggataaacaacggcgggttgcccat
atcctcgaacaactggatcaactggatatggttgggcaaattgtcaccaccgatgctgaa
gaactcacggcccaactcacagaagaaattcggctctggtggcgcaccgatgaactccat
caattcaagcccgaagtcttagatgaggtggaatatagcctccactatttcaaagaggtc
ttgtttgatgcgattcctcaactctatcgccgctttcaaaaagccctgcaccagagtttt
ccccaactgaagcccccccgctataacttctgtaaatttgggtcttgggtcggctcggat
cgagatggtaatccttctgttgttcccgaagtcacctggcaaaccgcttgttatcagcgc
aacttggttttagagaaatatgtttcctcggtggaacgcctgattaccctgttgagtttg
tctttacattggtgcgatgttttaccagaactgttggaatctctggagcaggatcaacaa
caactccccgatatttatcaacaacattcagttcgctttcgccaagaaccctatcgcctg
aaattagcctatgtcctgaaacggctgcaaaatacccgccagcggaaccaacagatccag
gccaattgtgctccctcggccgcggctgatgccttgaacaatggccaattttatggaact
gggactgattttttagcagagttaaacctgattcagcggaatttagcggccaccggcctg
gcctgtcgagaattggatgatctgatctgccaggtggaaatctttgggtttaacctagcc
attttagatattcgtcaagaaagtacgagtcactccgatacaattgccgaaatcaccgaa
tatctccagattcttccctgcccctacagtgagttatcagaaagtgagcggacgcgttgg
ttagccgcagaattggccactcgccgccccttaattccctccgagttgcctttttccgag
cggactaaggaaattattgaaaccttgcggatggtgaagcggctccaacaggaatttggc
ccggaaatctgcacgacttatgttatttccatgagccacgaggccagtgatttattggaa
gtgttgctgttagccaaagaagcaggcctctacgatccagccactggcaaaagtacgctc
catgtcgtgccgttgtttgaaactgtcgaagacttaaagcgcgccccccatgtcttaacc
caactgtttgaactccccttttacaaaccctacctgaacagtaatgattgcccaggcctg
caggaggtgatgctcggctactccgacagtaataaggattcagggtttttaagtagcaac
tgggaaatctataaagcccaacaatccctccaaaaaacggccgaaaaatatggcttccaa
ctgcggattttccatgggcgggggggatcagtcggtcgtgggggtggcccggcctatgcg
gcaattttggctcaacccggacaaaccatcaacgggcggatcaaaattacggaacagggg
gaagtcctcgcctcgaaatattccctccccgatctcgctctctataatttggaaaccatt
accacggcggtgatccaggccagccttttgcgcaccagcattgatgagattgaaccctgg
catgaaattatggaggagttggccacccgttcccgacagtgctatcggaatttaatctac
gaacgaccagaatttattgactttttccaccaagtcaccccgattgaagaaattagtcaa
ctccaaattagctctcggcccacgcggcgcggcggcaagaaaaatctggccagtttgcgg
gcaattccttgggtctttagttggacacaatcgcgctttttactcccggcctggtatgga
gttggcacagcgattaaagaatttattgatgaaaaaccggccgaacatctctcgctcctg
cgctatttctattacaaatggcccttttttcggatggtgatttccaaggccgaaatgact
ctcgccaaagtggatttggagattgcccaccattacgttcaagaattgagtcatgagcaa
gaccgagaaagctttgaaaccctctttgctcaaattgctgaggaatatcgccgcacttcg
gaactgattttgacgattaccgggcatcaacgcctcttggatggagatttgcccctgcaa
cggtctgtccatttacgcaacagtacgattgtgccgctgggggttctccaagtctcctta
ctgaagcgattacgccaacacaacagtacgagtacctctggggcgattctccggtcacgc
tatagccgcagtgaattgttacggggggcgttgttgacgattaacgggattgcggccgga
atgcgaaatacggggtga

DBGET integrated database retrieval system