KEGG   Synechococcus sp. KORDI-49: KR49_05210Help
Entry
KR49_05210        CDS       T03345                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00010  Glycolysis / Gluconeogenesis
synr00020  Citrate cycle (TCA cycle)
synr00620  Pyruvate metabolism
synr01100  Metabolic pathways
synr01110  Biosynthesis of secondary metabolites
synr01120  Microbial metabolism in diverse environments
synr01130  Biosynthesis of antibiotics
synr01200  Carbon metabolism
Module
synr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KR49_05210
   00020 Citrate cycle (TCA cycle)
    KR49_05210
   00620 Pyruvate metabolism
    KR49_05210
Enzymes [BR:synr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KR49_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AII45853
UniProt: A0A076H9W2
LinkDB All DBs
Position
complement(865641..866975)
Genome map
AA seq 444 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVESEAEIADAKASAPAAPAAAAPAPTATAPAPAPTPAPAPVAA
AAPVAAPPPAAIQPSAPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEK
ASGQPISVPRVAEGTAPAVTGGASSAAAAPAAPAGSSFGRPGETVPFNTLQGAVNRNMEA
SLAVPCFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMA
YPADVNVAVAVAMEDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYSTGTF
TLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIY
GADGAAFLKDLAELIETRPESLAL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacccacgacatcttcatgcctgccctcagctccaccatgacggagggcaagatc
gtggaatggctgaagcaacccggcgacaaggtcggacggggggagtcggtgctcgtggtc
gagtccgacaaggccgacatggatgtggagtcctttcaggacggctatctggccgcggtg
ctgatgccggccggcagcaccgcgccggtgggcgagacgatcggactgatcgtggaaagc
gaggcggagatcgctgatgccaaggcctcggctccggcagcccccgctgccgctgctcct
gcaccgacggccacagctcctgctcccgcaccgacgcctgcccccgcaccggtggctgcg
gcagctcccgtggcagctccgcctccggcagccattcagccgtctgctccggttgtcaac
gacggccgcatcgtcgccagcccccgtgccaagaagctggcgtctcagatgggcgtggat
ctggccaccgtgcgcggcagcggcccccacggccggatccaggcagaggacgtggagaag
gcgagcggtcaaccgatctccgttccgagggtcgccgagggcacagctcctgccgtcact
ggaggcgcgtcctctgctgcagcggcaccggccgcaccggctggcagcagcttcgggcga
cccggtgagaccgtgcccttcaacaccctgcagggggcggtcaaccgcaatatggaagcc
agcctggcggtgccctgcttccgtgtcgggtacacgatcaccaccgacaagctggatgcc
ttctacaaacaggtgaagcccaagggcgtcaccatgaccgccctgctggccaaggccgtg
gccgtcacgctggctcgccatccccaggtgaatgccgccaccacggcggccggtatggcc
taccccgccgacgtgaacgtggccgtggccgtggccatggaggacggcggcctgatcacg
ccggtgctgcgcaatgccgaccgcaccgatctctatgagatgtcacgccagtggggtgat
ctggtgaagcgctcccgcagcaagcagctgcagccggaggaatacagcaccggtaccttc
accctctccaatctcggcatgttcggtgtcgatcgcttcgatgcgatccttcctcccggc
accggcgcgatcctggcggtggcggcatcacgccccaccgtggtggccggcaaggacggt
tccatcgccgtgaagcgtcagatgcaggtgaatctgaccgccgatcaccgggtgatctac
ggggctgacggtgcggccttcctgaaggatctggcggagctgatcgagacccgccccgag
agtctggcgctctga

DBGET integrated database retrieval system