KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2223Help
Entry
SYNPCCP_2223      CDS       T01891                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SYNPCCP_2223 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCCP_2223 (rbcL)
Enzymes [BR:syq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SYNPCCP_2223 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2476240..2477652
Genome map
AA seq 470 aa AA seqDB search
MVQAKAGFKAGVQDYRLTYYTPDYTPKDTDLLACFRMTPQPGVPAEEAAAAVAAESSTGT
WTTVWTDNLTDLDRYKGRCYDLEAVPNEDNQYFAFIAYPLDLFEEGSVTNVLTSLVGNVF
GFKALRALRLEDIRFPVALIKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLGLSAKNY
GRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETNEMKGHYLNVTAG
TCEEMMKRAEFAKEIGTPIIMHDFFTGGFTANTTLARWCRDNGILLHIHRAMHAVVDRQK
NHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGERGITMGFVDLMREDYVEEDRSRGIFFT
QDYASMPGTMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATANRVALE
ACVQARNEGRNLAREGNDVIREACRWSPELAAACELWKEIKFEFEAMDTL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagccaaagcagggtttaaggcgggcgtacaagattatcgcctgacctactat
acccccgactacacccccaaggataccgacctgctcgcctgcttccgtatgaccccccaa
ccgggtgtacctgctgaagaagccgctgctgcggtggccgctgagtcttccaccggtacc
tggaccaccgtttggactgacaacctaactgacttggaccgctacaaaggtcgttgctat
gacctggaagctgttcccaacgaagataaccaatattttgcttttattgcctatcctcta
gatttatttgaagaaggttccgtcaccaacgttttaacctctttggtcggtaacgtattt
ggttttaaggctctgcgggccctccgtttagaagatattcgttttcccgttgctttaatt
aaaaccttccaaggccctccccacggtattaccgttgagcgggacaaattaaacaaatac
ggtcgtcctctgcttggttgtaccatcaaacccaaacttggtctgtccgccaagaactac
ggtcgggctgtttacgaatgtctccggggtggtttggacttcaccaaagacgacgaaaac
atcaactcccagcccttcatgcgttggcgcgatcgtttcctcttcgttcaagaggcgatc
gaaaaagcccaggctgagaccaacgaaatgaaaggtcactacctgaacgtcaccgctggc
acctgcgaagaaatgatgaaacgggccgagtttgccaaggaaattggcacccccatcatc
atgcatgacttcttcaccggcggtttcactgccaacaccaccctcgctcgttggtgtcgg
gacaacggcattttgctccatattcaccgggcaatgcacgccgtagttgaccgtcagaaa
aaccacgggatccacttccgggttttggccaagtgtctgcgtctgtccggcggtgaccac
ctccactccggtaccgtggttggtaaattggaaggggaacggggtatcaccatgggcttc
gttgacctcatgcgcgaagattacgttgaggaagatcgctcccggggtattttcttcacc
caagactatgcctccatgcctggcaccatgcccgtagcttccggtggtatccacgtatgg
cacatgcccgcgttggtggaaatcttcggtgatgattcctgcttacagtttggtggtggt
actttgggtcacccctggggtaatgctcccggtgcaaccgctaaccgtgttgctttggaa
gcttgtgttcaagctcggaacgaaggtcgtaacctggctcgcgaaggtaatgacgttatc
cgggaagcctgtcgttggtcccctgagttggccgccgcctgcgaactctggaaagagatc
aagtttgagttcgaggccatggataccctctaa

DBGET integrated database retrieval system