KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_1451Help
Entry
SYNGTI_1451       CDS       T01777                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Brite
Enzymes [BR:syt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SYNGTI_1451 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAL29198
LinkDB All DBs
Position
1606272..1606871
Genome map
AA seq 199 aa AA seqDB search
MAYALPNLPYDYTALEPCISKSTLEFHHDKHHAAYVNNFNNAVAGTDLDNQSIEDVIKAV
AGDASKAGIFNNAAQAWNHSFYWNCMKPGGGGQPSGALADKINADFGSFDAFVEAFKQAG
ATQFGSGWAWLVLDNGTLKVTKTGNAENPMTAGQTPLLTMDVWEHAYYLDYQNRRPDYIA
DFLGKLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcactacctaacttaccttacgactacaccgctctggaaccctgcatttcc
aaaagcaccctggagttccatcacgacaaacaccatgccgcctacgttaacaatttcaac
aatgcagtggcgggtactgatttagataatcaatccattgaagacgtaattaaagccgtt
gctggcgatgctagcaaagccggtattttcaacaacgccgcccaagcttggaaccatagt
ttctactggaattgcatgaagcccggtggtggtggccagccctctggtgccttggcggac
aaaatcaacgctgactttggtagctttgacgctttcgtggaagctttcaaacaagctgga
gccacccaattcggtagcggctgggcttggttggtgttagacaatggcactttgaaagtg
accaaaaccggcaacgccgaaaaccccatgaccgccggtcaaactcctttgctgaccatg
gacgtatgggagcatgcttactatttagactatcaaaaccgtcgtcccgattacattgcc
gatttcctcggtaagttggtcaactgggactttgtggcggctaacttagcagcggcctag

DBGET integrated database retrieval system