KEGG   Synechococcus sp. WH8102: SYNW2047Help
Entry
SYNW2047          CDS       T00144                                 

Gene name
ppc, pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00620  Pyruvate metabolism
syw00680  Methane metabolism
syw00710  Carbon fixation in photosynthetic organisms
syw01100  Metabolic pathways
syw01120  Microbial metabolism in diverse environments
syw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SYNW2047 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNW2047 (ppc)
   00680 Methane metabolism
    SYNW2047 (ppc)
Enzymes [BR:syw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SYNW2047 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAE08562
JGI: SYNW2047
CyanoBase: SYNW2047
CYORF: SYNW2047
UniProt: Q7U4M0
LinkDB All DBs
Position
1943187..1946219
Genome map
AA seq 1010 aa AA seqDB search
MIMRSPETSGASMPQSTAHVPDGEQPRASGGSPGAGRLLQHRLELVEDLWQTVLRSECPP
EQSERLLRLKQLSDPVALEGRDGESSSEAIVELIRSMDLSEAIAAARAFSLYFQLINILE
QRIEEDSYLDSLRPSRSQDDETAAPFDPFAPPLASQTDPATFGEVFERLRRMNVPPAQVE
TLLRELDIRLVFTAHPTEIVRHTVRHKQRKVASLLQRLQSEPALPRYDEEELRRQLEEEI
RLWWRTDELHQFKPTVLDEVDSTLHYFQQVLFEAMPQLRRRLVSSLSRHYPDVQFPQASF
CTFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLELYIGSVQSLRNQLSISMQWSQVAPP
LLESLEMDRLRFPEIYERRAARYRLEPYRLKLSYILERLELTLQRNHQMSEAGWQSPPEP
AATAPTDGIPGHEALHYTAIDQFRSDLELIRNSLVSTELSCEQLDTLLNQVHIFGFSLAS
LDIRQESTRHSDAIDELTTHLQLPKAYGAMEESERVAWLLEELQTRRPLIPAAVEWSEAT
AQTFAVFQMLHRLQQEFGQRICHSYVISMSHTASDLLEVMLLAKEIGLVDPQAGKASLLV
VPLFETVEDLQRAPAVMDGLFQTPIYRNLLPSVGVQRQPLQELMLGYSDSNKDSGFLSSN
WEIHQAQIALQTLASSHGVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQG
EVLASKYGLPELALYNLETVTTAVVQNSLVTNQLDATPSWNQLMSRVAKRSREHYRALVH
DNPDLVAFFQQVTPIEEISKLQISSRPARRKTGARDLSSLRAIPWVFGWTQSRFLLPSWF
GVGTALAEEVNDDPEQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMSSLGNPE
QRDAFEGIFKVIADEYGRTLKLVLEITGQSRLLGADQNLQLSVDLRNRTIVPLGFLQVAL
LRRLRDQNRQPPMSESPGTPEDRRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgcgcagtcccgagaccagcggagcgtcgatgccccagtccaccgcccatgtc
cccgacggcgagcagccaagggccagcggtggcagccccggcgccggccgcctgctgcag
catcgcctcgagctggtggaagacctgtggcagaccgtgctgcgcagcgaatgccccccg
gaacaaagcgagcgactgcttcgcctcaagcagctgagtgatccggtggccctggaaggc
cgcgacggtgagagcagcagcgaggcgatcgttgagctgatccgcagcatggatctctcc
gaggccatcgcagcagcccgtgctttctcgctgtatttccagctgatcaacatcctcgag
cagcgcatcgaagaagacagctatctcgacagccttcgtcccagccgcagccaggacgac
gagaccgcggcgccctttgatcccttcgcgccgcccctggccagccagaccgaccccgcc
acattcggcgaggtgttcgagcggctgcggcggatgaacgttccccccgcgcaggtggag
acgctcctgcgggaacttgacatccgactggtgttcaccgcccacccgacggaaatcgtg
cggcacaccgtgcggcacaaacagcggaaggtggcctccctgctgcagcggttgcagtca
gagccagcgctgccccgctacgacgaagaggaattgcgacgccagctggaggaggagatc
cgcctctggtggcgcaccgatgagctgcaccagttcaaaccgacggtgctggatgaggtg
gattcaaccctgcactacttccagcaggtgctgttcgaggcgatgccgcagctgcggagg
cggctggtgtcatccctgagccggcactaccccgatgtgcagttcccccaggcgtccttc
tgcaccttcgggtcctgggtggggtccgaccgcgacggcaacccctcggtcaccccggag
atcacctggcggaccgcctgttatcagcgccagctgatgctggagctctacatcggctcg
gtgcaatccctgcgcaaccagctgagcatctcgatgcagtggagccaggtggccccacca
ctgctggaatcgctggaaatggaccggctgcgcttcccggaaatctatgagcgccgggcc
gcccgctatcggctggagccctaccggctcaagctcagctacatcctcgaacggctggag
ctcacgctgcagcgcaaccatcagatgtcggaggctggctggcagtcgccgcccgaaccc
gccgccacagcgccaaccgatgggatcccgggccatgaggcgctgcactacaccgccatc
gatcagttccgcagtgatctggaactgatccgcaacagcctcgtcagcaccgagctgagc
tgcgaacagctcgacaccctgctcaatcaggtccacatcttcgggttctccctggcgagc
ctggacatccggcaggagagcacccgccacagcgacgccatcgatgagctgaccacccac
ctgcagcttccaaaggcctacggcgccatggaggaatccgagcgggtggcctggctgctg
gaggaactgcagacccgccggccgctgatccccgcggcggtcgaatggtccgaagccacc
gcccagacctttgcggtgttccagatgctgcatcgcctgcagcaggaattcggtcagcgg
atctgccactcctacgtgatctccatgagtcacaccgcctccgacctgctggaggtgatg
ctgctggcgaaggagatcggccttgtggacccgcaggccggcaaggcatcgctgttggtg
gtgcccctgttcgaaacggtggaagacctgcagcgggccccagcggtgatggacggcctg
ttccagacaccgatctaccggaatctgctccccagtgtcggcgtccagcgacagcccctg
caggagctgatgctcgggtactccgacagcaacaaggactcgggcttcctctccagcaac
tgggagattcaccaggcgcagatcgccctgcaaaccctggccagcagccacggtgtggcc
ctacggctgttccacggccggggtggatcggtgagccgcggcggcggcccggcctaccag
gccatccttgcccagcccagcggcacactgcagggccggatcaagatcaccgaacagggt
gaggtgctggcctccaagtacggcctgccggaacttgccctctacaacctggaaaccgtc
acgacggcggtggtgcagaacagcttggtgaccaaccagctggatgccaccccgagctgg
aaccagttgatgagccgcgtggccaagcgctcccgcgagcattaccgggccctggtccac
gataaccccgatctggtggcgtttttccagcaggtcaccccgatcgaggagatcagcaag
ctgcagatctccagccgtccggctcgccgcaagaccggcgcccgggatctctccagtctg
cgggcaatcccctgggtgttcggctggacccaaagccggttcctgctgccgagctggttc
ggtgtgggcaccgccctggcggaggaggtcaacgacgaccctgagcaactggacctgctg
cggcgactgcatcagcgctggccgtttttccggatgctgatttccaaggtggagatgacg
ctgtccaaggtcgatctcgacctggcgcaccactacatgagcagcctcggcaacccggag
cagcgcgatgcctttgaaggcatcttcaaggtgatcgccgatgaatacggccgcaccctg
aagctggtgctcgaaatcaccggtcagagccgcctgctgggggccgatcagaacctgcag
ctgtcggtggatctgcgcaaccgcaccattgttcccctgggcttcctgcaggtggccctg
ctgcggcgactgcgggatcagaaccgccagcctcccatgagcgaatcccctggaacgccg
gaggaccgccgcacctacagccgcagtgaactgctgcggggcgcattgctcaccctcaac
ggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system