KEGG   Synechococcus sp. WH8102: SYNW2047Help
Entry
SYNW2047          CDS       T00144                                 

Gene name
ppc, pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syw  Synechococcus sp. WH8102
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SYNW2047 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNW2047 (ppc)
   00680 Methane metabolism
    SYNW2047 (ppc)
Enzymes [BR:syw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SYNW2047 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1943187..1946219
Genome map
AA seq 1010 aa AA seqDB search
MIMRSPETSGASMPQSTAHVPDGEQPRASGGSPGAGRLLQHRLELVEDLWQTVLRSECPP
EQSERLLRLKQLSDPVALEGRDGESSSEAIVELIRSMDLSEAIAAARAFSLYFQLINILE
QRIEEDSYLDSLRPSRSQDDETAAPFDPFAPPLASQTDPATFGEVFERLRRMNVPPAQVE
TLLRELDIRLVFTAHPTEIVRHTVRHKQRKVASLLQRLQSEPALPRYDEEELRRQLEEEI
RLWWRTDELHQFKPTVLDEVDSTLHYFQQVLFEAMPQLRRRLVSSLSRHYPDVQFPQASF
CTFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLELYIGSVQSLRNQLSISMQWSQVAPP
LLESLEMDRLRFPEIYERRAARYRLEPYRLKLSYILERLELTLQRNHQMSEAGWQSPPEP
AATAPTDGIPGHEALHYTAIDQFRSDLELIRNSLVSTELSCEQLDTLLNQVHIFGFSLAS
LDIRQESTRHSDAIDELTTHLQLPKAYGAMEESERVAWLLEELQTRRPLIPAAVEWSEAT
AQTFAVFQMLHRLQQEFGQRICHSYVISMSHTASDLLEVMLLAKEIGLVDPQAGKASLLV
VPLFETVEDLQRAPAVMDGLFQTPIYRNLLPSVGVQRQPLQELMLGYSDSNKDSGFLSSN
WEIHQAQIALQTLASSHGVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQG
EVLASKYGLPELALYNLETVTTAVVQNSLVTNQLDATPSWNQLMSRVAKRSREHYRALVH
DNPDLVAFFQQVTPIEEISKLQISSRPARRKTGARDLSSLRAIPWVFGWTQSRFLLPSWF
GVGTALAEEVNDDPEQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMSSLGNPE
QRDAFEGIFKVIADEYGRTLKLVLEITGQSRLLGADQNLQLSVDLRNRTIVPLGFLQVAL
LRRLRDQNRQPPMSESPGTPEDRRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgcgcagtcccgagaccagcggagcgtcgatgccccagtccaccgcccatgtc
cccgacggcgagcagccaagggccagcggtggcagccccggcgccggccgcctgctgcag
catcgcctcgagctggtggaagacctgtggcagaccgtgctgcgcagcgaatgccccccg
gaacaaagcgagcgactgcttcgcctcaagcagctgagtgatccggtggccctggaaggc
cgcgacggtgagagcagcagcgaggcgatcgttgagctgatccgcagcatggatctctcc
gaggccatcgcagcagcccgtgctttctcgctgtatttccagctgatcaacatcctcgag
cagcgcatcgaagaagacagctatctcgacagccttcgtcccagccgcagccaggacgac
gagaccgcggcgccctttgatcccttcgcgccgcccctggccagccagaccgaccccgcc
acattcggcgaggtgttcgagcggctgcggcggatgaacgttccccccgcgcaggtggag
acgctcctgcgggaacttgacatccgactggtgttcaccgcccacccgacggaaatcgtg
cggcacaccgtgcggcacaaacagcggaaggtggcctccctgctgcagcggttgcagtca
gagccagcgctgccccgctacgacgaagaggaattgcgacgccagctggaggaggagatc
cgcctctggtggcgcaccgatgagctgcaccagttcaaaccgacggtgctggatgaggtg
gattcaaccctgcactacttccagcaggtgctgttcgaggcgatgccgcagctgcggagg
cggctggtgtcatccctgagccggcactaccccgatgtgcagttcccccaggcgtccttc
tgcaccttcgggtcctgggtggggtccgaccgcgacggcaacccctcggtcaccccggag
atcacctggcggaccgcctgttatcagcgccagctgatgctggagctctacatcggctcg
gtgcaatccctgcgcaaccagctgagcatctcgatgcagtggagccaggtggccccacca
ctgctggaatcgctggaaatggaccggctgcgcttcccggaaatctatgagcgccgggcc
gcccgctatcggctggagccctaccggctcaagctcagctacatcctcgaacggctggag
ctcacgctgcagcgcaaccatcagatgtcggaggctggctggcagtcgccgcccgaaccc
gccgccacagcgccaaccgatgggatcccgggccatgaggcgctgcactacaccgccatc
gatcagttccgcagtgatctggaactgatccgcaacagcctcgtcagcaccgagctgagc
tgcgaacagctcgacaccctgctcaatcaggtccacatcttcgggttctccctggcgagc
ctggacatccggcaggagagcacccgccacagcgacgccatcgatgagctgaccacccac
ctgcagcttccaaaggcctacggcgccatggaggaatccgagcgggtggcctggctgctg
gaggaactgcagacccgccggccgctgatccccgcggcggtcgaatggtccgaagccacc
gcccagacctttgcggtgttccagatgctgcatcgcctgcagcaggaattcggtcagcgg
atctgccactcctacgtgatctccatgagtcacaccgcctccgacctgctggaggtgatg
ctgctggcgaaggagatcggccttgtggacccgcaggccggcaaggcatcgctgttggtg
gtgcccctgttcgaaacggtggaagacctgcagcgggccccagcggtgatggacggcctg
ttccagacaccgatctaccggaatctgctccccagtgtcggcgtccagcgacagcccctg
caggagctgatgctcgggtactccgacagcaacaaggactcgggcttcctctccagcaac
tgggagattcaccaggcgcagatcgccctgcaaaccctggccagcagccacggtgtggcc
ctacggctgttccacggccggggtggatcggtgagccgcggcggcggcccggcctaccag
gccatccttgcccagcccagcggcacactgcagggccggatcaagatcaccgaacagggt
gaggtgctggcctccaagtacggcctgccggaacttgccctctacaacctggaaaccgtc
acgacggcggtggtgcagaacagcttggtgaccaaccagctggatgccaccccgagctgg
aaccagttgatgagccgcgtggccaagcgctcccgcgagcattaccgggccctggtccac
gataaccccgatctggtggcgtttttccagcaggtcaccccgatcgaggagatcagcaag
ctgcagatctccagccgtccggctcgccgcaagaccggcgcccgggatctctccagtctg
cgggcaatcccctgggtgttcggctggacccaaagccggttcctgctgccgagctggttc
ggtgtgggcaccgccctggcggaggaggtcaacgacgaccctgagcaactggacctgctg
cggcgactgcatcagcgctggccgtttttccggatgctgatttccaaggtggagatgacg
ctgtccaaggtcgatctcgacctggcgcaccactacatgagcagcctcggcaacccggag
cagcgcgatgcctttgaaggcatcttcaaggtgatcgccgatgaatacggccgcaccctg
aagctggtgctcgaaatcaccggtcagagccgcctgctgggggccgatcagaacctgcag
ctgtcggtggatctgcgcaaccgcaccattgttcccctgggcttcctgcaggtggccctg
ctgcggcgactgcgggatcagaaccgccagcctcccatgagcgaatcccctggaacgccg
gaggaccgccgcacctacagccgcagtgaactgctgcggggcgcattgctcaccctcaac
ggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system