KEGG   Synechococcus sp. WH7803: SynWH7803_1742Help
Entry
SynWH7803_1742    CDS       T00524                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syx  Synechococcus sp. WH7803
Brite
Enzymes [BR:syx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SynWH7803_1742 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAK24168
CyanoBase: SynWH7803_1742
CYORF: SynWH7803_1742
UniProt: A5GMK3
LinkDB All DBs
Position
1594105..1594704
Genome map
AA seq 199 aa AA seqDB search
MAHTLPALPYALDALEPHISRSTLEFHHGKHHNGYVTNLNKAIEGTDLDGKSLEEVISAV
SGDASKAGVFNNAAQVWNHSFYWQCMKPGGGGQPSGALLDKINADFGSYDAFVEQFKAAG
ATQFGSGWAWLIVENGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYIT
TYLEKLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcccataccctccctgcgctgccctacgccctcgatgcgctggagccccacatctcc
cgctccacgctcgagttccaccacggcaagcaccacaacggttacgtcaccaacctgaat
aaggcgatcgagggcacggatctcgacggcaaaagcctcgaagaagtgatctccgctgtg
tccggtgacgccagcaaggccggcgtgttcaacaacgctgcccaggtttggaaccacagc
ttctactggcagtgcatgaagcccggtggtggtggtcagcccagtggagccctcctcgac
aagatcaacgctgacttcggcagctacgacgccttcgttgagcagttcaaggctgctggt
gccacccagttcggcagcggctgggcctggttgatcgtcgagaacggcacgctcaagatc
accaaaaccgccaacgctgatcttcctctggcccacggtcagaaggctctgctcaccatg
gacgtgtgggagcacgcctactacctcgactatcagaaccgccgccccgattacatcacc
acctacctcgagaagctggtgaattgggatttcgtggccgccaacctggctgccgcctga

DBGET integrated database retrieval system