KEGG   Siansivirga zeaxanthinifaciens: AW14_05140Help
Entry
AW14_05140        CDS       T03699                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sze00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AW14_05140
  Amino acid metabolism
   00310 Lysine degradation
    AW14_05140
   00380 Tryptophan metabolism
    AW14_05140
Enzymes [BR:sze01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AW14_05140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1112091..1114832
Genome map
AA seq 913 aa AA seqDB search
MDKFSFLNAAHTAYFADLYDQYLQNPDSVEPSWRAFFQGYDFGSENYGFEGEIVEGVSAQ
MPEYLQKEFQVIKLIDGYRMRGHLFTKTNPVRDRRTYEPTLDIENFGLSANDLDTVFNAG
EILGIGAKPLREILVHLNKIYCSSIGVEYMYLRNPEVISWWQGKLNHNDNQPSFSATKKK
YILSKLNQAVTFENFLQTKYVGQKRFSLEGGESLIPAISNVLFVAAEKYDVKECVLGMAH
RGRLSTLVNIFRKPVNELFSEFDGKDFEDADIDGDVKYHLGLTLDKTYQNGKNIKMNLVP
NPSHLETVASVAEGITRAKIDTDYNGDDQKIIPIIVHGDAAIAGQGIVYEVAQMSQLNGY
KTGGTVHIVVNNQIGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVVHAVELALE
YRMRYKKDVYIDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHKNPFEIYSSKLISEKTIDK
DYVDAIVEEFKSTLEAEYIKSKEADSSKVREFMQERWQGFEREDLEGMLKPVDTSYPKEN
LENISKVVSTVPKDVKFVRKAERILEGRAKMVFETDTLDWGMAETLAYGSLLEEGFNVRI
SGQDVERGTFSHRHAILRDEISEERVNLLNLNPHNKGKMDIFNSFLSEYGVLGFDYGYAM
ANPNTLTIWEAQFGDFSNGAQIIFDQYLSAAEDKWKSQNGIVVLLPHGYEGQGSEHSSAR
IERYLQLCGDDNMTVADCTTPANMYHLLRRQMLRKFRKPLIVFTPKSLLRHPKAVSSISE
LASGEFQEVIDDTINPENVKKLVLCTGKFYYDLLAEREELGREDIALVRIEQLFPLHIDK
IQAAINRYPNVEKYVWAQEEPRNMGAWSYLTQRLDIVKLEGITRPYNSVPAPGSGTRDKS
RQRRVINAVFENN
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggataaattttcctttttaaacgcagcgcatacagcttattttgctgatttatacgat
caatatttacaaaacccagattctgtagaaccaagttggagagccttttttcaaggttac
gattttggtagcgaaaactatggttttgaaggtgaaatagtagaaggagtttcggctcaa
atgccagaataccttcaaaaagagtttcaggttattaagttaattgatggttatagaatg
cgcgggcatttgtttacaaaaacaaaccctgttagagatcgaagaacttacgagccaact
ttagatattgaaaattttggtctttccgcaaacgatttagataccgtttttaacgctggc
gaaattttaggaattggagccaaaccacttcgcgaaattttggtgcatttaaataaaata
tactgtagttctattggagtagagtatatgtatcttagaaatccagaggttatttcttgg
tggcaaggtaaattaaaccacaacgataatcagcctagtttttcggcgactaagaaaaaa
tatattctttcaaaattaaaccaagcggttactttcgaaaactttttacaaactaaatat
gttggacagaaacgtttttctctagaaggaggcgaatctttaattccggctattagtaat
gtgcttttcgttgctgccgaaaaatacgatgttaaagaatgtgttttaggtatggcacac
agaggacgtttaagtacgctggtaaatatatttagaaaaccagtaaacgaactttttagc
gagtttgatggtaaagattttgaagatgcagatatcgatggtgatgttaaatatcattta
ggtttaaccttagataaaacctatcaaaacggtaaaaatattaagatgaatttggttcca
aatccatcgcatttagaaaccgtagcttctgtagccgaaggtattacaagagctaaaata
gacaccgattataatggcgacgaccaaaaaattataccaattatagtacatggagatgct
gccattgcaggtcagggtatagtttatgaagtagcccagatgagtcagttaaatggttac
aaaacaggtggaacggtacatattgtagttaacaaccaaattgggtttacaacaaactac
ttagatgcacgttcaagtacctattgtaccgatgttgctaaagtaactttgtcgcctgta
ttacacgtaaatgccgacgatgccgaggctgtagttcatgcagtagagttagcattagag
tacagaatgcgttacaaaaaagatgtttacatcgatttgttaggttatagaaaatatgga
cataatgaaggtgacgaaccaaggtttactcagcctaaactttataaagccatagcaaaa
cataaaaatccgtttgaaatttattcaagtaaattaatttcggaaaaaaccatcgataaa
gattacgtagatgctattgttgaagaatttaaatcaacactagaagcagaatacataaaa
tcgaaagaagcagattcgtctaaggtaagagagtttatgcaagaacgctggcaaggattt
gagcgtgaagatttagagggtatgttaaagcctgtagatacatcgtatccaaaagagaat
ttagagaacatttctaaagtggtttcaacagtaccaaaagacgttaaatttgttagaaaa
gcagaacgtattttagaaggtcgtgcaaaaatggttttcgaaaccgatactctagattgg
ggtatggcagaaacattggcttacggtagtttactagaagaaggttttaatgttagaatt
tctggacaagatgtagagcgcggtacttttagtcacagacatgctattttacgtgatgaa
atatcagaagaacgtgttaatcttttaaatttaaatccacataacaagggtaaaatggat
atttttaattcatttttatctgaatatggggtgttaggtttcgattatgggtatgccatg
gccaacccaaatacattaaccatttgggaagcgcagtttggagactttagtaatggtgct
caaattatatttgaccaatatttatcggctgcagaagataaatggaaatctcaaaatggt
attgtagttttacttcctcatggttatgaagggcaaggttcagagcattcatctgcacga
atcgagcgttacttacaactttgtggagacgataacatgacggttgcagactgtaccaca
cctgcaaatatgtaccacttattacgtcgccaaatgttacgtaagtttagaaaaccgtta
atagtttttactcctaaaagtttattacgtcaccctaaagcggtttctagtattagcgaa
ttagcatcaggagaatttcaagaagttatcgatgatactatcaacccagaaaacgttaag
aaattagtactttgtactggtaaattctattacgatttattagcagaaagagaagaatta
ggtagagaggatatcgctttagtaagaattgagcaattattcccgctacatattgataaa
attcaggcagcaataaatcgttatcctaatgtagaaaaatacgtttgggcgcaagaagaa
ccacgcaatatgggtgcttggagttatttaactcagcgtttagatattgtgaaattagaa
ggtatcacaagaccttataattctgtacctgctccaggttcgggcaccagagataaaagt
agacaacgtcgcgttattaatgcggtttttgaaaataattaa

DBGET integrated database retrieval system