KEGG   Trichoplax adhaerens: TRIADDRAFT_37971Help
Entry
TRIADDRAFT_37971  CDS       T01069                                 

Definition
(RefSeq) expressed hypothetical protein
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 276 aa AA seqDB search
MKILVIVALFACATAFRLPPAFKQVPRPADWRPQPKWEVDDDKIVGGVEATQNEFPFIVS
LRRKPWWLGSTASHFCGGSIIGANKVLTAAHCTSGTSASDINVAAGQFDKSSDSDDNEQI
RTALRKSEHSDYNSQTIDMDFAVLTMSSSFTLNTNVAKITMGGAQPGQMLTVSGWGTLSA
GGSSPNNLQRVDVPAITNTECNAAYKGGITDNMLCAGYSAGGKDSCQGDSGGPLVRFDGT
TPTLVGVVSWGNGCAEPGYPGVYARCSKEQSWIMSQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttggttattgtcgctcttttcgcttgcgctaccgccttcaggcttccacct
gcttttaagcaagtaccacgcccagctgattggcgcccacaaccaaaatgggaagttgac
gatgacaagatcgtcggtggagtagaagctacacaaaatgagttcccattcatcgtttcc
ttgagaaggaagccttggtggctcggcagcactgcttctcacttctgtggtggttccatc
attggagctaacaaagttctcactgctgctcactgtacttccggtacctctgcttctgat
attaacgttgctgctggtcaatttgacaaaagcagtgattctgacgacaatgaacaaatt
cgaactgctttgaggaaatctgagcattccgactataactctcaaacaattgatatggat
ttcgcagtcttgacaatgtctagctcgtttacattaaacacaaatgttgctaaaattaca
atgggaggagctcaacctggtcaaatgcttactgtttctggttggggtactctttccgca
ggtggttcctcccctaacaatcttcaaagagtagatgtccctgctatcacaaatactgaa
tgtaatgctgcctataagggcggaatcaccgataacatgctatgcgctggttacagtgct
ggtggcaaagattcttgtcaaggtgacagtggtggcccattggtccgttttgatggtaca
actccaacccttgtcggtgttgttagctggggcaatggctgtgctgaaccaggatatcca
ggcgtttatgcccgttgctcgaaagaacaaagctggatcatgtcacagtaa

DBGET integrated database retrieval system