KEGG   Trichoplax adhaerens: TRIADDRAFT_55983Help
Entry
TRIADDRAFT_55983  CDS       T01069                                 

Definition
(RefSeq) expressed hypothetical protein
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6753404
NCBI-ProteinID: XP_002111694
JGI: 55983
UniProt: B3RTN0
LinkDB All DBs
AA seq 408 aa AA seqDB search
MTLKKSVNYEDCHRFIVYFRLGYRQATCGSTSYAKSGTIESPSYPSNYPRRTDCTSTVVA
SSDEVVTVTFSEFDVESATNCKYDYVSLYDGNTLRHTYCGKGSVPTFTTSPGSNFVLTFH
TDGSVQKKGFALSFTVTKVAAPTGSTTGTVSTGTYNPGTCGKTAYKLSLTDRIVGGAECS
PKHALPWQVSLQTNTGFHFCGGSIISDRYVVTAAHCVDGQTPTSWRIVLGAHNIGSNEPS
QFVATVKRAKMHPSYDTSTLSNDIAIIELNEKITFTNEISPVCVSKTRIADNADVIVSGW
GTLTAGGASPDTLQRVIVPTISRSECSSTVYGTGYIDSTMLCAGLMSGGKDSCQGDSGGP
LVHDRSGTYYLEGVVSWGYGCADPNRPGVYARVSSLYSFLETETGLTF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaaaaaatcagttaactatgaagactgccatcgttttattgtctattttcgc
cttggctaccgccaagctacttgcggttctacttcctacgcaaagagcggcaccatcgaa
tctcccagctacccaagcaactatcctaggagaactgactgtacctctaccgttgttgct
tcgagtgatgaagttgttaccgttaccttcagcgagtttgatgttgaatctgctaccaac
tgcaaatatgattacgtttctctttatgatggtaatacccttaggcacacctactgcggt
aaaggtagcgttcctaccttcactacttcccctggttctaacttcgtgttaactttccac
actgatggatctgtacagaagaagggattcgctcttagcttcaccgttactaaagttgct
gctcctactggtagcactactggcactgtcagcactggtacttataacccaggcacctgt
ggtaaaacagcatataaactatccctgaccgaccgtatcgttggtggtgcagaatgtagc
ccaaaacatgcccttccatggcaagtatctctccaaaccaacactggcttccatttctgt
ggtggttccatcatcagtgatagatatgttgttactgctgctcactgcgttgatggacaa
actccaacctcctggagaattgttcttggtgctcacaacatcggaagcaatgaacctagc
caatttgttgccactgtcaagagagctaaaatgcatcctagctacgacaccagtaccctc
agcaatgacattgctatcatagaattaaacgaaaaaatcactttcactaatgaaatttcc
ccggtctgtgtatccaaaactagaattgctgataatgcagacgtcatagtctctggctgg
ggtactttaacagctggtggcgcctcgcctgataccttgcaaagagtaatcgttcctacg
atctctcgctctgagtgtagctctacagtctatggcacaggttacattgatagcaccatg
ttgtgcgctggtcttatgtctggtggcaaagattcctgccaaggtgacagtggtggccca
cttgttcacgatcgatctggtacctactacttggaaggtgttgtcagctggggctatggt
tgcgccgatcctaaccgtccaggtgtttatgctcgtgtttccagcttgtacagcttcttg
gaaacagaaaccggtctgaccttctaa

DBGET integrated database retrieval system