KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0531Help
Entry
TepiRe1_0531      CDS       T02434                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00473  D-Alanine metabolism
tae01100  Metabolic pathways
tae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tae00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TepiRe1_0531 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TepiRe1_0531 (alr)
Enzymes [BR:tae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TepiRe1_0531 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:tae01011]
 Precursor biosynthesis
  Racemase
   TepiRe1_0531 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDI40408
UniProt: F4LVA6
LinkDB All DBs
Position
520430..521611
Genome map
AA seq 393 aa AA seqDB search
MPKELLNIRPTWAEINLDDLRHNLLEIRRITSTNAKLCAIVKADGYGHGAVEVAQTALSC
GAHYLGVAFLDEAVELREKGIKAPILILGFTPENQFDTIIEHDITQTVYSLKSAILLSEK
ALKRKKKAKVHIKLDTGMSRIGFQTDASSISDIRKLFQLEGLKVEGILTHFAKADEKDRT
VTEEQFRIFTEAVNTIEAKDYKIPIKHIANSAGIIEYPNTHLDMVRPGIILYGMYPSDEI
TKSKIHLKPILSLKTRVAHVKSLPKGKAISYGGTYITERHTIIATLPVGYADGYSRLLSS
RAQVLINGQRAPVVGRICMDQCMVDVTDIQGEVKPKDEVTLIGADGSERIEAEDIAKIIG
TINYEITCGISKRVPRVYISNGKIQNIKNFLVK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagaacttctaaatatcagacctacttgggctgagattaatttagatgattta
cgacataacttattggaaattagaagaattacttccaccaacgccaaattatgtgcgata
gtaaaggcagatggatacggacacggagccgtagaagttgcacagactgctctttcttgt
ggagcacattatcttggagtggcatttttggatgaagcagtagaactaagggaaaaaggc
ataaaagcacccatccttattttgggttttacacctgaaaatcaatttgatacaataata
gaacacgatattactcagaccgtatatagtctaaaatctgcaattttgctttctgaaaag
gctttaaagcgaaagaaaaaagccaaagttcatataaaacttgatacgggtatgagccgg
ataggttttcaaacggatgcatcttctatttcagatatcagaaaactgtttcagcttgag
ggcctaaaagtagaaggcattttgactcattttgcaaaggcagatgaaaaagatagaaca
gttactgaagaacaatttcgaatttttactgaagcggtaaatactattgaagcaaaagac
tacaagataccaataaagcatattgctaatagtgcgggtattatagagtatccaaataca
catcttgatatggttcgaccaggcattatcctttacggcatgtatccttcagatgaaatt
accaaaagtaaaatccatttaaaacccatactgagtttaaaaactcgagtagctcatgtt
aagtcattgccgaagggcaaagcaattagctatggtggaacatatataactgaaaggcat
accattattgcaacactaccggtggggtatgctgatggctactcaagactgctttcgtcc
cgagcccaggtactgataaatgggcaacgagctccggttgtaggacgtatttgcatggat
caatgcatggtagatgttactgacatacaaggtgaggtaaaaccgaaagatgaagttaca
ttaattggagccgatggcagcgagagaatcgaggctgaagacatagcaaaaatcatagga
actataaattatgaaataacttgtggtatatcaaaaagagtgccaagggtatatattagt
aatggtaaaatacaaaatatcaaaaattttttggtaaaatag

DBGET integrated database retrieval system