KEGG   Thermosphaera aggregans: Tagg_0643Help
Entry
Tagg_0643         CDS       T01237                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
tag  Thermosphaera aggregans
Pathway
tag00500  Starch and sucrose metabolism
tag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tagg_0643
Enzymes [BR:tag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Tagg_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: ADG90916
JGI: Tagg_0643
UniProt: D5U1B6
LinkDB All DBs
Position
complement(606280..607839)
Genome map
AA seq 519 aa AA seqDB search
MVMSMTSIVFLFEVHQPYRLDRRMHEKLIEKALNNNIDYEDIQEAIFDNSLNKYVIERAA
KRCYIPATKIIVENLKRYKDTLKPFKVSFSISGVFLEQASKWAPGIIEVLQEAVTTGMVE
LVEQTYYHSIAAFLPSYGFEELREQVLQHREAMKSFFGYEPVSIENTEFTFNNDLACFFY
NMGYRVVITEGVDHVLGWRSPNYVYKAWGCDARVLARNYRLSDDVGFRFSDKKWDQYPLT
ADKYASWLAATPGDLVFLAMDYETFGEHHWPESGIHEFLRWLPGEVLKYGHLEFSTPREV
AEKYSPRDVFDVPPWSTISWADERDLSAWIGNVMQQEAVRALASLYPFVKASEEPGLIRL
WKMLSISDHFYYMATKFGTIEEVHAYFSPFKNASIAYGLFMEALGVLSELIQEKISEKPG
KIASKLILPMDKAFYFTMPDGSYTGVYARSLMELYTKIGSVPLESAVYHLRSGHIPAWIE
QALLLKELSKRIRELTREVDDPVKLVELVRKEISSYLQG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgagcatgacaagcattgtttttctatttgaggttcaccagccctataggctt
gacaggagaatgcatgagaagcttattgaaaaggctttgaacaacaatattgactacgag
gatattcaagaagccatatttgacaattctcttaacaaatacgttattgagagagccgct
aaaagatgctacatcccggcgacgaaaataatagttgaaaatcttaagagatacaaggat
actttgaaaccatttaaagtatcattcagcattagcggcgtgttcctcgagcaggcgtct
aaatgggctccgggtattattgaggttcttcaagaagctgtgacgaccggaatggtagag
ctggtggagcagacctactatcacagcatagcagcgtttcttcccagctatggttttgaa
gaattgagggagcaggtgcttcagcatagggaagcgatgaagagtttcttcggttatgag
ccggtttccattgagaacaccgagtttactttcaacaatgatttagcttgcttcttctac
aacatggggtacagggtcgtcataacggagggtgttgaccacgttctcggttggagaagc
cctaattacgtgtataaagcatggggttgtgatgccagggttttagcaagaaactataga
ttgagcgatgacgtcgggttcaggtttagcgataagaaatgggatcaatacccgctgacc
gcagataagtatgcttcatggttagcggccactccaggcgatttagtgttcctagctatg
gattatgagacgtttggagaacatcattggccggagtctggtattcacgagttccttaga
tggcttcctggcgaagtcttgaaatacgggcacttagaattctcaacgcctcgggaggtg
gctgagaagtattctcctagagacgtttttgacgttccaccatggtccacgattagttgg
gctgatgagagagatttgagtgcatggattgggaacgttatgcagcaagaagcggttagg
gctttagccagcctatacccgtttgtgaaggcatcagaggaacccggtttaataaggctg
tggaagatgttaagtataagcgatcacttctactatatggctaccaagttcgggacaata
gaagaagtccacgcctacttctcccccttcaagaatgctagcatagcttatgggttgttt
atggaggcgctgggagtactttccgagttaatacaggagaagattagcgagaagcccggc
aagattgcttctaagctaatactgccgatggataaagcgttttactttacaatgcctgat
ggttcctatacaggtgtttatgctagatcattgatggagctgtatactaaaatcgggagc
gtcccgttggaaagcgcagtttaccacttgagaagcgggcatataccagcctggattgaa
caggccctgcttttaaaggaactgtcgaagagaattcgggaattaacgcgagaagtggat
gatcctgttaagctcgtggaactcgttagaaaggagatttcctcttacctacagggctga

DBGET integrated database retrieval system