KEGG   Thiomicrospira aerophila: THIAE_05080Help
Entry
THIAE_05080       CDS       T03589                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
tao  Thiomicrospira aerophila
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:tao00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    THIAE_05080
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    THIAE_05080
Transporters [BR:tao02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    THIAE_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1041410..1042228)
Genome map
AA seq 272 aa AA seqDB search
MSNIASQERIKNYGQYAKNHVAPPLLVLIVLLLLWEWLTSGATATLPSPTRVLSETWELI
INPFYDHGGNDVGMGWQILASLERVAYGFTLAVIVGVSLGVLVGQSTLAMRGLDPIFQVL
RTVPPLAWLPLSLAGFQHSDPSAIFVIFITAIWPIIINTSVGVRNISEDYRNVARVLNLN
GYEYFTKIMLPAAAPYIFSGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSQISEI
VLALIYVGIVGFILDRMVAFVGNKVTRGTSAS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatcgcatcgcaagagcgcatcaaaaattatggccagtatgctaaaaaccat
gtagcaccaccattactggttcttatcgttttattactactttgggaatggctaacttcg
ggagcaactgcaacactgccatccccgacccgagtattgtcggaaacctgggagttaatc
atcaaccctttttatgatcatggtggtaatgatgtagggatgggttggcaaatcttagcc
agtcttgaacgtgtagcctatggttttaccctagcggtgattgtaggggtcagtttgggc
gttctggtgggtcagtctaccctagctatgcgcggtcttgatcctatctttcaagtattg
cgcactgtaccgcctttggcttggttgccactatccttggctggttttcagcatagtgat
ccatcagccatttttgtaatctttatcaccgcgatttggcccattattatcaacacatcg
gtaggggttcgaaatatttccgaagattatcgcaatgtcgcacgtgtgcttaatctaaat
ggttatgagtatttcactaaaatcatgcttcctgctgctgcaccctatattttctctggg
ttgcggatcggtgttggtttgtcttggttagcgattgttgcagctgaaatgttgattggt
ggcgtagggattggcttctttatctgggatgcttggaactcatcgcaaattagtgaaatt
gtattggcactgatctatgtgggtatagttgggtttattttggatcgaatggtggccttt
gtgggcaataaagtaacccgcggcacatcagcaagctaa

DBGET integrated database retrieval system