KEGG   Thermococcus barophilus: TERMP_00788Help
Entry
TERMP_00788       CDS       T01377                                 

Definition
(GenBank) tungsten-containing formaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tba  Thermococcus barophilus
Pathway
tba00030  Pentose phosphate pathway
tba01100  Metabolic pathways
tba01120  Microbial metabolism in diverse environments
tba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TERMP_00788
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TERMP_00788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADT83765
UniProt: F0LLB4
LinkDB All DBs
Position
687774..689636
Genome map
AA seq 620 aa AA seqDB search
MKGWWGRILRVDLTNNKVKVQEYSPEIAQLFIGGRGLAAKILWDEVKGVDPLSPENKLVI
AAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNIGTMATVHLRKAGYDAIVIEGKAKKPVY
LYVEDDNVSILSAEGLWGLDTFKTEEELKKIHGKNVGILSIGPGGENLVKYAVIMSQEGR
AGGRPGIGAVMGSKKLKAVVIKGTKEIPVADKEELRKLSKEAYDEILSKPTYEFWHRQGT
MAAVEWTNENSALPTYNFQDGSFKFARSIDGYTLEGMKVKQRGCPYCNMPCGNVVLDAEG
LESELDYENVALLGSNLGIGQLNKVAVLNRLADMYGLDTISLGGSIAFVMEAVEKGLLKE
GPTFGDYKGAKELVKEIAFRSSELGNFAAEGVMRMAQKVEGGENFAMHVKGLEVSGYNSY
IYPAMALAFATSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYSPEKAAKVIELQR
YRGGLFEMLSACRLPWIEVGLSIDYYPKLLKAITGVTYTWDDLFAAADRLYALIRAYWVR
EFNGNWSRRMDYPPKRWFIEGLKSGPYKGKHLEEDKYDKLLSEYYKMRGWDERGIPTKET
LQKLKLDFVIPELEKVTELH
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttggtggggaagaattttaagagtcgatttaacaaacaacaaagtcaaagtg
caggaatattctccagaaattgctcaactcttcatcggtggaaggggattggcagcaaag
attctctgggatgaagtcaagggagttgatcctcttagcccagaaaacaagcttgtcata
gctgctggaccatttaacggccttccaacgccaagcggaggaaaattggttgttgcagct
aagagtccacttactgggggatatggggacggaaacataggaacaatggcaactgtgcat
cttagaaaggctggttatgatgccattgttattgaaggaaaagccaaaaagcccgtgtat
ctttacgttgaagatgataatgtaagtattctcagtgctgaaggattgtggggtcttgac
acctttaagacagaagaagagctgaagaagatccacggcaagaatgtgggcatattaagc
attggaccgggtggcgagaatttagtgaaatatgcagttataatgtcacaagaaggaaga
gctggaggaagacccggtattggtgcagtaatgggaagcaagaagctcaaggctgttgta
attaaaggaacaaaggaaattccagtggcagataaagaagagttaagaaaactaagcaaa
gaggcttatgatgagatattgagcaagccaacctatgagttctggcaccgtcagggaacg
atggcagctgtagaatggacaaatgaaaactcagcacttccaacatacaacttccaagac
ggttcattcaagtttgcaagatcaattgatggttacaccctggagggcatgaaggtcaag
cagcgtggctgtccttactgtaacatgccctgtggaaacgttgttcttgacgccgagggc
ttggagagcgagctcgattatgaaaatgtagcattgttgggctcaaaccttgggattgga
cagctcaacaaggttgcagttttgaacagactcgccgacatgtacggtcttgacacaata
tctttgggtggctcaatagcgtttgtcatggaagctgttgagaaaggacttctcaaagaa
ggcccaacattcggagactacaagggagcaaaagaacttgtcaaagagattgcattcagg
agtagcgagcttggaaacttcgccgctgaaggtgtaatgagaatggctcaaaaagtggaa
ggaggagaaaactttgcaatgcacgttaaaggattggaagtaagcggttacaacagttat
atctatcccgcaatggcacttgcatttgcaacatcatcaatcggtgcccaccacaaggaa
gcatgggttattgcttgggaaatcggtacagcaccaattgaaggagagcaggcaaagaag
gttgagtacaagattacatatagcccagaaaaggctgcaaaggttattgagctgcagaga
tacagaggtggactgttcgagatgctctctgcatgtaggttgccatggattgaggttggg
ctaagcattgactattatccaaagctcctgaaggcaataactggagtcacatacacatgg
gacgacctctttgcagcagctgacaggctatatgcattgattagagcttactgggttaga
gagttcaacggaaactggagcagaaggatggactacccaccaaagagatggttcattgag
ggacttaagagcggaccatacaagggcaagcaccttgaggaggacaagtacgacaagctg
ctcagtgaatactacaagatgcgcggctgggacgagagaggaattccaactaaggaaaca
ctccagaagctcaagcttgacttcgtcattccggagcttgagaaggttacggagcttcat
taa

DBGET integrated database retrieval system