KEGG   Thermus brockianus: A0O31_01698Help
Entry
A0O31_01698       CDS       T04600                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
tbc  Thermus brockianus
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A0O31_01698
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0O31_01698
   00620 Pyruvate metabolism
    A0O31_01698
   00630 Glyoxylate and dicarboxylate metabolism
    A0O31_01698
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A0O31_01698
   00680 Methane metabolism
    A0O31_01698
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A0O31_01698
Enzymes [BR:tbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     A0O31_01698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1529026..1530009)
Genome map
AA seq 327 aa AA seqDB search
MKSPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPIILQLLEIPQALRALDGVIMELEDC
AFPLLAGVVATDDPKVAFKDADYALLVGAAPRKAGMERRDLLEMNGKIFTEQGRALAEVA
KKEVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGVAVDRIRR
IAVWGNHSSTMFPDLFHAEVDGKPALELVDMEWYEKEFIPTVAGRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEEDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGEYRIVEGLTIN
EFARKRMEITAQELLDEMAQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccctgttcgcgtggcggtcaccggcgccgcaggccagatcggttatagcctt
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagcccatcatcctgcagctt
ctggaaatcccccaagccctgagagccctagatggggtcatcatggagctggaggactgc
gccttcccgcttttggccggggtggtggccaccgacgaccccaaggtggcctttaaggac
gccgactacgcccttctggtgggggcggccccccgtaaggcgggcatggagcggcgcgac
ctcctggagatgaacggcaagatcttcaccgagcagggccgggccctggcggaggtggcc
aagaaggaggtgaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgccccgggcctaaacccccggaacttcaccgccatgacccgcctggaccac
aaccgggccaaggcccagctggccaagaagacgggggtggccgtggaccggatccgccgc
atcgccgtctggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacgggaagccggccctggaactcgtggacatggaatggtacgagaaggagtttatcccc
accgtggcggggcggggtgcggccatcatccaggcccggggggcctccagcgccgccagc
gccgccaacgccgccattgagcacatccgcgactgggccttgggcacgccggaggaggac
tgggtatccatggccgtcccctcccaaggggagtacggcatccccgagggcatcgtctac
tccttccccgtgaccgccaaggacggggagtaccgcattgtggaggggcttaccatcaac
gagttcgcccgcaagcgcatggaaatcacggcccaagagctcctggacgagatggcgcag
gtgaaggccctaggcctcatctaa

DBGET integrated database retrieval system