KEGG   Thiobacillus denitrificans: Tbd_0162Help
Entry
Tbd_0162          CDS       T00275                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbd_0162 (pykA)
   00620 Pyruvate metabolism
    Tbd_0162 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    Tbd_0162 (pykA)
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Tbd_0162 (pykA)
Exosome [BR:tbd04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tbd_0162 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
174936..176369
Genome map
AA seq 477 aa AA seqDB search
MIRRTKIVATLGPACSDAKTLDRMMEAGLDVVRLNFSHGVAQDHIDRAELVRSLARTRGR
AVGVLVDLQGPKIRIGKFKDNKIVLAKGDNFILDAECALGDQERVGLDYKELPSDVARGV
TLLLDDGRIELWVEDVKGSEIHCKVVQGGVLSNNKGINRKGGGLSAAALTEKDIEDIKTA
AALKADYLAVSFPRSGADMRQARELLRAAGGRSQLVAKIERTEAIENLEEILDASDAIMV
ARGDLGVEVGDAAVPALQKRMIRMAIARNKVVITATQMMESMITSPIPTRAEVSDVANAV
LDGTDAVMLSAETAAGQYPVEAVQAMDRVCLEAEKEAETQFTRERLDHSFLRADEAIAMS
AVFTSVHLNIKAIAALTESGNTCLWMSRLSTRVPIYALTPQVETRRKVTLFRGVYPINLK
TATKERDVLLAEAEEELRRRGAVRDGDLILLTIGEPIGQSGGTNTMKIVRVGASKKP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcagaaccaaaatcgtcgccaccctcggccccgcctgctccgacgccaagacg
ctcgatcggatgatggaagccggcctggacgtggtccgtctcaacttctcccacggcgtg
gcgcaggaccacatcgaccgcgccgaactcgtgcgttcgctcgcgcgtacgcgcggtcgc
gcggtcggcgtcctcgtcgacctgcaggggccgaagatccgcatcggcaaattcaaggac
aacaagatcgtcctcgccaagggcgacaacttcatcctcgacgcggaatgcgcgctcggc
gaccaggagcgcgtcggcctcgactacaaggaattgccgagcgacgtcgcccgtggcgtg
acgctcctgctcgacgacggccggatcgaactctgggtcgaagacgtcaagggcagcgaa
atccactgcaaggtcgtgcagggcggcgtgctctcgaataacaagggcatcaaccgcaag
ggcggcggtctttcggccgccgcgctgaccgagaaggacatcgaggacatcaagaccgcc
gcggcgctcaaggccgactacctcgcggtctccttcccgcgctcgggcgccgacatgcgc
caggcgcgcgagttgctgcgggccgcgggcggcaggagccagctcgtcgccaagatcgag
cgcactgaagcgatcgagaacctcgaagaaatcctcgatgcgtccgacgcgatcatggtc
gcccgcggcgacctcggcgtcgaggtcggcgacgctgcggtgccggcgctgcagaagcgc
atgatccgtatggcgatcgcgcgcaacaaggtcgtcatcaccgcgacgcagatgatggag
tcgatgatcacgagcccgatcccgacccgcgccgaagtctccgacgtcgccaacgccgtg
ctcgacggcaccgacgccgtcatgctctcggccgagaccgcggccgggcaatacccggtc
gaagccgtgcaggcgatggaccgcgtctgcctcgaagccgaaaaggaagccgagacgcag
ttcacgcgcgagcggctcgaccacagcttcctgcgcgccgacgaggcgatcgcgatgtcg
gccgtgttcacctcggtgcacctcaacatcaaggccatcgccgcgctgaccgagtccggc
aatacctgtctgtggatgagccgcctgtcgacgcgcgtgccgatctacgccttgacacct
caggtcgaaacccgtagaaaagtcactctcttccgcggtgtctatccgatcaacctcaag
accgccaccaaggagcgcgacgtgctgctcgccgaggccgaggaagaattgcggcggcgc
ggcgccgtgcgcgacggcgacctgatcctgctgacgatcggcgagccgatcggccagtcg
ggcggcaccaatacgatgaagatcgtccgtgtgggcgcttcgaagaaaccctga

DBGET integrated database retrieval system