KEGG   Thermobispora bispora: Tbis_2533Help
Entry
Tbis_2533         CDS       T01236                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tbi  Thermobispora bispora
Pathway
tbi00010  Glycolysis / Gluconeogenesis
tbi00053  Ascorbate and aldarate metabolism
tbi00071  Fatty acid degradation
tbi00280  Valine, leucine and isoleucine degradation
tbi00310  Lysine degradation
tbi00330  Arginine and proline metabolism
tbi00340  Histidine metabolism
tbi00380  Tryptophan metabolism
tbi00410  beta-Alanine metabolism
tbi00561  Glycerolipid metabolism
tbi00620  Pyruvate metabolism
tbi00625  Chloroalkane and chloroalkene degradation
tbi00903  Limonene and pinene degradation
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_2533
   00053 Ascorbate and aldarate metabolism
    Tbis_2533
   00620 Pyruvate metabolism
    Tbis_2533
  Lipid metabolism
   00071 Fatty acid degradation
    Tbis_2533
   00561 Glycerolipid metabolism
    Tbis_2533
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tbis_2533
   00310 Lysine degradation
    Tbis_2533
   00330 Arginine and proline metabolism
    Tbis_2533
   00340 Histidine metabolism
    Tbis_2533
   00380 Tryptophan metabolism
    Tbis_2533
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tbis_2533
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tbis_2533
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tbis_2533
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Tbis_2533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Wtap YCII DnaB_bind
Motif
Other DBs
NCBI-ProteinID: ADG89235
JGI: Tbis_2533
UniProt: D6Y4Q9
LinkDB All DBs
Position
complement(2967383..2968789)
Genome map
AA seq 468 aa AA seqDB search
MRQLYVNGAWVPSASDEAIDVINPATEEVIDRVPAGSPDDVEAAVRAARDAFPSWAETPP
AERAKYLAAAADLLTKRADEIARTIATDMGAPLQFALKVQTLMPAMVLSSYAEIAQRYAF
DAGTVGNAQILKEPAGVVGAITPWNYPLHQIVCKVAPALAAGCTIVLKPSEVAPLAAYAL
AGVFEEIGLPRGVFNLVSGYGPVVGEAIAAHPEVDVVSFTGSTRAGRRVAALAAETVKRV
ALELGGKSANVILPGADLERAVKVGVASAFQNSGQTCSAWTRMLVHQDFYAEAVRLAAGF
AGKYPVGDPFAEGTRLGPLVSAAQRERVVRYIERGLEEGARLVTGGTGNPMERGYYVEPT
IFSDVAPGMTIEQEEIFGPVLAVIPYRDEDEAVAIANGTPYGLAGAVWAESDEKALEVAR
RLRAGQVAVNGGKFNVLAPFGGYKQSGIGRELGEFGLEEYLEVKAVLR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagctctatgtgaacggtgcctgggtcccgtccgcctcggacgaggccatcgat
gtgatcaatcccgcgaccgaggaggtcatcgaccgggtgccggccggcagcccggacgac
gtggaggcggcggtgcgcgccgcccgcgacgccttcccctcctgggcggagacgcccccg
gccgaacgcgccaagtacctggccgccgcggcggacctgctgaccaagcgcgccgacgag
atcgcccggacgatcgcgaccgacatgggcgctccgctgcagttcgcgctcaaggtgcag
acgctgatgcccgccatggtgctctcgtcgtacgccgagatcgcgcagcggtacgccttc
gacgccgggacggtggggaacgcccagatcttgaaggagcccgcgggcgtggtcggggcg
atcaccccgtggaactacccgctccaccagatcgtctgcaaggtggccccggcgctcgcg
gcggggtgcacgatcgtgctcaagccgagcgaggtggcgccgctcgccgcctacgcgctc
gccggcgtcttcgaggagatcggcctgccgcgcggcgtgttcaacctggtgagcggttac
ggcccggtcgtgggcgaggcgatcgccgcgcaccccgaggtggacgtggtgtcgttcacc
ggctcgacccgggccggccggcgggtggcggcgctcgcggccgagacggtgaagcgggtg
gccctggagctcggcggcaagtcggcgaacgtgatcctgcccggcgccgacctggagcgg
gcggtgaaggtcggggtggcgagcgcgttccagaactcgggccagacctgctcggcgtgg
acgcgcatgctcgtccaccaggacttctatgcggaggcggtacggctcgccgcgggcttc
gccggcaagtacccggtgggggacccgttcgccgagggcacccggctcgggccgctcgtc
tcggccgcccagcgggagcgggtggtccgctacatcgagcgcggcctggaggagggcgcc
cggctggtgaccggcggcacgggcaacccgatggagcgcggctactacgtcgagccgacg
atcttcagcgacgtggcgccggggatgacgatcgagcaggaggagatcttcggcccggtg
ctcgcggtgatcccctatcgcgacgaggacgaggccgtggccatcgccaacggcacgccg
tacggcctcgcgggcgcggtgtgggcggagagcgacgagaaggcgctcgaggtggcgcgg
cggctgcgcgccgggcaggtggcggtgaacggcggcaagttcaacgtgctggcgccgttc
ggcggctacaagcagtccggcatcggccgcgagctcggcgagttcggcctggaggagtac
ctcgaggtcaaggccgtgctgcggtga

DBGET integrated database retrieval system