KEGG   Thermobispora bispora: Tbis_3396Help
Entry
Tbis_3396         CDS       T01236                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
tbi  Thermobispora bispora
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Tbis_3396
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Tbis_3396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3966247..3967488)
Genome map
AA seq 413 aa AA seqDB search
MITRAECESLDDKDPLRAFRDEFRLPPGVVYLLGNSLGALPKRTPERVAHTVETEWGRDL
TASWNKAGWWDLPQTTGDRIAPLIGAGPGQVIAGDSTSVNIFKAVSAALPLRPGRRVIVS
DLDNFSTDRYVVEGIAKTMGYEVREIGWGEGAPGLDEALGDDVACVLLSHVDYRTGARHD
MASVTARVHAAGAIMIWDLCHSAGAMPVDVGEADFAVGCTYKYLNGGPGAPAYLYVAPRH
QEVVQNAICGWHGHAAPFAFEPYYRPAAGVRRFATGSPPVLAYAALNASLDIWERVDLER
LREKSLALTSLFIELVDELAPASRSGLTLVTPRDPERRGSQVSYRHPEGYPIVRALADRG
VIADYREPELVRFGFAALYLRHVDVYDAATALAEVIESEPWRDERYRQRLTVT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatcactcgcgccgaatgcgagtccttggatgacaaggaccccttgcgggccttccgg
gatgagttccggcttccgccgggcgtcgtctacctgctcggcaactccttgggggcgctc
cccaagcggaccccggaacgggtcgcccataccgtggagaccgagtggggccgggacctc
accgcgagctggaacaaggcgggctggtgggacctgccgcagaccaccggtgaccggatc
gccccgctgatcggcgcgggcccggggcaggtgatcgcgggcgactccacctcggtgaac
atcttcaaggccgtctccgccgcgctgccgctgcgccccggccgccgcgtcatcgtctcc
gatctcgacaacttctccacggaccggtacgtggtcgagggcatcgccaagaccatgggg
tacgaggtccgggagatcggctggggcgagggcgctcccggcctcgacgaggcgctcggc
gacgacgtcgcctgcgtgctcctctcccacgtggactaccgcacgggcgcgcggcacgac
atggcctcggtcaccgcccgggtccacgcggccggcgcgatcatgatctgggacctgtgc
cactccgccggggcgatgcccgtcgacgtgggggaggcggacttcgcggtcggctgcacc
tacaagtacctcaacggcggccccggcgcgcccgcgtacctctacgtcgccccccgccac
caggaggtcgtgcagaacgcgatctgcggctggcacgggcacgccgcgccgttcgccttc
gagccgtactatcggcccgcggccggggtgcggcggttcgccacgggcagcccgcccgtg
ctcgcctacgccgcgctcaacgcgtcgctcgacatctgggagcgggtggacctggagcgg
ctgcgggagaagagcctggcgctgacctcgctgttcatcgagctcgtcgacgagctcgcc
cccgcctcccgcagcgggctcaccctggtcaccccgcgcgacccggagcggcgcggcagc
caggtgagctaccgccacccggagggctacccgatcgtccgcgcgctcgccgaccgcggg
gtcatcgccgactaccgggagcccgagctggtccggttcggcttcgccgcgctctacctc
cgccacgtcgacgtctacgacgccgcgaccgcgctcgccgaggtgatcgagagcgagccg
tggcgggacgagcggtaccggcagcggctcaccgtcacctga

DBGET integrated database retrieval system