KEGG   Thermoanaerobacter brockii: Thebr_0368Help
Entry
Thebr_0368        CDS       T01409                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
tbo  Thermoanaerobacter brockii
Brite
Translation factors [BR:tbo03012]
 Eukaryotic Type
  Elongation factors
   Thebr_0368
 Prokaryotic Type
   Thebr_0368
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Thebr_0368
Exosome [BR:tbo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Thebr_0368
  Exosomal proteins of breast cancer cells
   Thebr_0368
  Exosomal proteins of colorectal cancer cells
   Thebr_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
397263..398465
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERKKPHVNVGTIGHVDHGKTTLTAAITMVLSKAGMAEAKGYDEIDKAPEERARG
ITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDPELIELVEMEVRELLNEYEFPGDDTPIVVGSALKALE
CGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVEDVFTITGRGTVATGRVERG
KVKVGDEVEIIGLTTESRKTVVTGVEMFRKTLDEAQAGDNIGVLLRGVQRDEVERGQVLA
KPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVINLPDGVEMVMPG
DHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgagaggaagaagccccacgtaaacgtagggacgataggtcac
gtagaccatggtaagacgacgttgacagcagcgataacgatggtattatcgaaggcagga
atggcagaggcgaagggatatgacgagatagacaaggcgccggaggagagagcaagggga
ataacgataaacacgactcacgtagaatatgagacagagaagaggcactatgcgcacgta
gactgtccaggacatgctgactatgtaaagaacatgataacaggggcagcacagatggac
ggggcgatattagtagtatcagcagcagacggaccgatgccacagacgagggaacacata
ttattggcgaggcaggtaggagtgccatatatagtagtatttttaaacaaggcagacatg
gtagacgatccagaattaatagaattagtagagatggaagtaagggaattattgaatgaa
tatgagtttccgggggatgacacaccgatagtagtagggtcagcacttaaggcattagag
tgtggatgtggcaagagagagtgcgaatggtgcgggaagatatggcagttaatggatgta
gtagacgaatatataccgacaccggagagagacatagacaagccattcttaatgccagta
gaggacgtatttacgataacaggaagaggaactgttgcgacagggagagtagagagaggg
aaggtaaaggtaggagacgaagtagagataataggattgacgacggaatcaaggaagaca
gtagtaacaggggtagagatgttcaggaagacactggatgaggcgcaagcaggagacaac
ataggagtattattaagaggagtacagagggacgaagtagagagagggcaagtattagcg
aagccagggacgataaagccgcacacgaaatttgaggcacaagtttacgtattgacgaag
gaagaaggaggaaggcacacaccatttttcaatggatacaggccacaattttactttagg
acgacagacgttacaggtgtaataaacttgccggatggagtagagatggtgatgccaggt
gaccacgtaacgataaaagtagagttaataacaccgatagcgatggaagaaggtttgaag
tttgctataagagaaggcggccgtacagtaggtgctggcgtcgtgtcagctatcatagaa
taa

DBGET integrated database retrieval system