KEGG   Thermococcus barossii: A3L01_06790Help
Entry
A3L01_06790       CDS       T05081                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tbs  Thermococcus barossii
Pathway
tbs00630  Glyoxylate and dicarboxylate metabolism
tbs01100  Metabolic pathways
tbs01120  Microbial metabolism in diverse environments
tbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3L01_06790
Enzymes [BR:tbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3L01_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ASJ05086
LinkDB All DBs
Position
complement(1251570..1252901)
Genome map
AA seq 443 aa AA seqDB search
MVEKFEIYDIYVDKDYEPNPKRDLVAVFRITPAEGFSIEDAAGAVAAESSTGTWTSLYQW
YEKERWDDMSAKAYHFHDMGDGSWIVRIAYPVHLFEEWNMPGMLASVAGNVFGMKRVKGL
RLEDIYLPEKFLREFEGPYFGKDGVKRIFDVKDRPIVGTVPKPKVGYSPEELEKLAYDLL
SGGMDYIKDDENLTSPWYNRFETRAEILMNVIDRVEDETGEFKSWFANITADVREMERRL
EILADYGNPHAMVDVVVTGWGALEYIRDVAADYGIAVHGHRAMHATFTRNPYHGISMFVL
AKLLRVIGIDQLHVGTAGAGKLEGGKWEVIQYARIFREEHYVPDETDVFHMEQKFYHIKP
AMPVSSGGLHPGNIEPVIDALGKDIVLQIGGGTLGHPDGPKAGAMAVRQALDAIMQGIPL
DEYAKTHKELARALEKWGHVTPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaagtttgagatatacgacatctacgtcgataaggactacgaacccaacccc
aagagggatctcgtagcagtcttcagaataacacccgctgaggggttcagcatcgaggat
gctgctggagccgtcgcagcagagagctcgaccggaacctggacgagcctctaccagtgg
tacgagaaggaaagatgggacgacatgtcggctaaagcgtaccacttccacgacatgggc
gacggcagctggatagtgaggatagcctatccggttcacctgttcgaggagtggaacatg
cccggcatgctcgcgagcgttgccggtaacgtctttggaatgaagcgtgttaagggtctc
cgccttgaggacatctatctgccggagaagttcctccgcgagttcgagggaccgtacttc
ggaaaggatggcgtcaagaggatttttgatgtcaaggacaggcccatcgtcggaacagtc
cccaagcccaaggtgggatattcgccagaggagcttgaaaagctcgcctacgacctgctc
agcggcgggatggactacatcaaggacgatgagaacctgaccagtccctggtacaaccgc
tttgagaccagggcggagattctgatgaacgtcatagacagggtcgaggacgagaccggt
gaattcaagagctggttcgccaacatcaccgccgatgtgcgcgagatggagcgcaggctt
gagatactcgccgactacggcaacccacacgccatggttgatgttgtggtcaccggctgg
ggggcgctggagtacatcagggacgtcgcggccgattacggcatagccgtccacggccac
agggctatgcacgctaccttcacgaggaacccctaccacggcatctcgatgttcgtcctt
gcaaagcttctacgcgtcataggtatagaccagctccacgttggtaccgccggagcaggg
aagcttgagggcggcaagtgggaggtcatccagtacgcgagaatattcagggaggagcac
tacgttcccgatgagaccgacgttttccacatggagcagaagttctaccacatcaagccg
gccatgcctgtcagctcgggtggccttcaccccggcaacatcgagccggtcatagacgca
cttggaaaggacatcgtcctccagattgggggaggaaccctcggccatccggacgggccg
aaggccggggcgatggctgtcagacaggcccttgatgccatcatgcagggtatcccgctc
gatgagtacgcgaaaacgcacaaagagctcgccagggccctcgaaaagtggggtcatgtc
acaccggtctga

DBGET integrated database retrieval system