KEGG   Tribolium castaneum (red flour beetle): 100142246Help
Entry
100142246         CDS       T01046                                 

Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100142246
Peptidases [BR:tca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100142246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG2
AA seq 588 aa AA seqDB search
MHVFFLFLTSLLVTNAHVQVFKPQIDVRIVGGHATTIEEHPHQVSVIYIDSHYCGGSIIH
TRFILTAAHCTYQLTAEDLLVRAGSTMVNSGGQVRGVAQIFQHKNFDIDTYDYDISVLKL
SESLVLGSGVAVIPLPEDGSTVPGDLLGTATGWGRLSENGPLPVELQEVDLPTIQDNVCA
LMYGDRLTERMFCAGYPKGQKDTCQGDSGGPYEYEQMLIGITSWGDGCGAANSPGVYTRV
SYFIQYIDDIIKNNIHGDLKMPTIDVRIIGGHAVDIEDYPYQVSIMYIDSHMCGGSLIQP
NLILTAAHCIEDKRVSYEINQSKPLYKRRIFNFLPKPAMLPLIILALVITVNGAPHFDGR
IVGGRTATIEEYPYQVSLHYYGFHICGGSIISPVYVITAAHCTNGNFDMALTVRAGSSAP
NRGGQEITVKKVYQNPLFTVKTMDYDISVLHLFNSIDFSLSALPIGLAPRNYKVSLGTNV
TVTGWGLLAEEGESPDQLQVVEIPYITNEKCQKAYEKEEMTISERMLCAQAEFGGKDSCQ
GDSGGPLVADGLLVGIVSWGFGCARPEYPGVYSRISEFRDFIKNVTQL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcttctttttgtttttaacaagtctgcttgttacaaacgcccacgttcaggtg
ttcaagcctcagatcgatgttcgaatcgttggtggtcatgccaccaccatcgaagaacac
ccacaccaagtttcagtgatttacattgatagtcactactgtggcggttctattatccac
actagatttattctaactgcggctcattgcacctaccaacttacagctgaagatttgcta
gttcgtgctggctccactatggtaaattccggtgggcaagtgcgcggagtcgcccagatt
tttcaacacaaaaactttgatattgatacttacgactatgacatttcggtactgaaattg
tccgagagtttggttttagggagtggagttgcagtgattccgctccctgaggatggtagt
actgttcctggggaccttctgggaacagcgactgggtgggggagactttctgaaaatggg
cctcttcctgtggagctacaagaagttgacttgcccactattcaggataatgtctgtgca
ttgatgtacggggataggctgactgagaggatgttttgtgcgggttatcccaaaggacaa
aaggacacatgccaaggcgattctggagggccatacgagtatgaacaaatgctaatagga
atcacgtcatggggagacggttgtggtgccgcaaatagtccaggagtctacaccagagtg
tcttatttcatacaatatatagatgatattataaaaaataacattcatggcgatttaaaa
atgccaaccattgatgtccgtattattggtggccatgctgtagatattgaagactatcct
tatcaagtctcaattatgtacattgacagtcatatgtgtggcggttctctgattcaacct
aacttaattctaaccgcagcacattgtatcgaggacaaaagagtctcttacgaaataaat
caatcgaaaccactatataaacgcagaatttttaacttcctaccaaaaccagcaatgctc
ccactaataatcctagctcttgtgatcaccgttaatggtgccccacattttgacggcaga
atcgtcggtggaagaacagcaaccatcgaagaatacccttaccaagtatccttacattac
tatggcttccatatttgtggcggctctattataagcccggtctatgtcataacagcggct
cattgcaccaacggaaactttgatatggccctaactgtgagagctggatccagcgccccg
aacagaggtggtcaggaaataacggtgaagaaagtctaccaaaacccactttttacggtt
aaaactatggattacgacatttccgttttgcatcttttcaactcgattgactttagttta
tcggcgctgccaattgggttagctccacgtaactacaaagtttccctcggtactaacgtc
acggtgaccggctgggggttgctggctgaagagggcgaaagtccggaccagctacaagtc
gtggaaattccctacatcacgaacgaaaagtgccaaaaagcttatgagaaggaggagatg
acgatcagcgagcggatgctttgtgctcaagccgagttcggcggcaaggactcgtgccag
ggcgattccggcgggcctttggtggccgacggcctcctggtcggcatcgtgtcctggggc
ttcggctgcgcacggcccgagtaccccggcgtgtactcgcgcatctccgaattccgcgat
ttcatcaaaaatgtaacacagttgtaa

DBGET integrated database retrieval system